tg1665

Coordinates:1572348-1572953

>tg1665 hypothetical protein TGAM_1665
MRTFIIKANEAHTRPDFKLNDLPGTSGRIDVLCRFLNSAFLLSHGFRKNVRVWLLLYGPPEPPKAIRFEGSRLKVRLNPD
ERSTARLIVKALKAGGGLREPGKEVEVYPGLYVSNRTFEDVVRLTLKNSAIYYLHEEGRPITDIRFPQNVAFVLGDHKGL
SPEDEAFLDGIAERVSVGRKSYLASHVVAYINIFLDSLPNPP

>tg1665 hypothetical protein TGAM_1665
atgaggacgttcataatcaaggcgaacgaggctcacacaaggccggatttcaagctgaacgatcttccggggacgagcgg
caggatagacgtcctttgcaggttccttaactcggcttttctactctcacacggcttccggaagaacgtgcgcgtctggc
tcctcctctatggcccgccggagcctccgaaggcgatacgctttgaaggctctaggctgaaggttcgcctcaaccctgac
gagaggagcacggcgaggctcatagtgaaggccctcaaggccggcggaggattaagggagccggggaaggaggtggaggt
ttaccccggcctctacgtcagcaacaggacctttgaggacgtcgtgagacttactctgaaaaactcagccatttattatc
tccatgaggaggggaggccgataactgatatccgcttccctcagaacgttgccttcgtcttgggggatcataaggggctc
agcccggaagacgaggcttttctggacggaatagcggagagggtgagcgtggggaggaagagctacctcgcctcgcacgt
cgtcgcttacattaacatattcctcgactcccttccgaaccctcct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1571848 - 1573453 (Additional range around tg1665 is :500nt.)

>Thermococcus gammatolerans EJ3 CATAAGCGTCCGCGGAAACAGGCTCTTCTACATTCAGGCCGTCCACCAGGAGAGCGACGTCGTTCCAGAGAACATCGACG CGATAAGGGCGATGTTTGAGCTCGCCGAGAAGTGGGAGAGCATAAGAAAGACAAACGAGAGCCTGGGGATTTTGAAGTGA TTACAGCCCCAGCCTTTTCTTTACATCCTCCGCGCTCATCCTGACCAGTAAATCCTTCTCCCTGCTCGTCTCCCCGCGAA CCAGCTCAACTTCAGCTCCAAGAACCTTCGACAAGAACTTAACGAGCTCCTTGTTTGCCTTCCCTCCGACGGGCGGGGCC TTTACCTTAACTTTCAATCTTCCACGCCACTCGTCGATTCCCTCAATCTCGTTCTTCTTGGCCTTCGGCTGGACGTAGAC GAGCAGGAGGGTTCCGTCTTTGGTCTCCTTCAGGAACTTCATCTCACCACCCTGACCCCAATGGGATAACCTCTTTAAAC TTCTTTCCCAACCCTCTTC atgaggacgttcataatcaaggcgaacgaggctcacacaaggccggatttcaagctgaac gatcttccggggacgagcggcaggatagacgtcctttgcaggttccttaactcggcttttctactctcacacggcttccg gaagaacgtgcgcgtctggctcctcctctatggcccgccggagcctccgaaggcgatacgctttgaaggctctaggctga aggttcgcctcaaccctgacgagaggagcacggcgaggctcatagtgaaggccctcaaggccggcggaggattaagggag ccggggaaggaggtggaggtttaccccggcctctacgtcagcaacaggacctttgaggacgtcgtgagacttactctgaa aaactcagccatttattatctccatgaggaggggaggccgataactgatatccgcttccctcagaacgttgccttcgtct tgggggatcataaggggctcagcccggaagacgaggcttttctggacggaatagcggagagggtgagcgtggggaggaag agctacctcgcctcgcacgtcgtcgcttacattaacatattcctcgactcccttccgaaccctcct TAATACTTCCACA CGATTTCGGGCGGGAACTGGCCGCGCTCGGCCTTCTCAATTATCTCCCTTGCGACCCTGTAGGCGAAGTCAAAGGTTTCT CTGTCGATCAGCCCGTAGTTGAGGGCCATCTCAAGCTCGTCCTCGTCGAGGAGAAAAGCCCTCCCGTCGGGGAAGATGAA GACGTCGAGGAAGAGGTCAAGCATCTCTACTGTGTTTCCCTCGCGCTTCGTGTACGCCAAGATGTCAACGTAGAGCCCCT TGAAGTTCCCCTCCTCGTCGTAGACCTTCAAAATGTCGTAGTTCTCCCCGATGAAGGCGAAGTAGAGCATGGTATAGCCG TTCCTGATAACTTCGACGCCGTTCACCCTCAACGGGGCGAGCATGCCCTCGAAACGGGATTTTGCGATGATCACGTCACC CAGATCCGCTATAACTTCATCGTCCCGCTCGAGAACCCTGTTGGGAATCCTTCGGTAGATCAGGTGAACCCTTGCCATGG TTCCCAG