tg1681

Coordinates:1586912-1587142

>tg1681 LSU ribosomal protein LXA (rplXA)
MEVKVYRVKGIFQRGKLKQPFTKEYRALKPEHVEELVYSEIGSKHRVPRTKIWIESIEEIKPEEAENPVVRRLSLEL

>tg1681 LSU ribosomal protein LXA (rplXA)
atggaggtcaaggtctaccgcgttaagggaatcttccagaggggtaagctcaagcagcccttcaccaaggagtaccgtgc
tcttaagccggagcacgtcgaggagcttgtctactccgagatagggagcaagcaccgcgttccgaggaccaagatatgga
ttgagagcatcgaagagataaagccagaagaggctgagaacccggtcgttagaaggctcagccttgagctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1586412 - 1587642 (Additional range around tg1681 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAGCTCGACTTCATAAACGCCCAGCTCAGGGAGTACGGAATTGACATGGAGGTCGTCCCCTTCCAGAGCAGGCTCACCG CCTTTGGGAACCTGATTCTGGCCAACGACAAAGGTGCTCTGGTCAGCAAGGACTTCACGAGGGAAGAGGCGAGGAAGATT GAGGACATACTCGGTGTCCCCGTCGAGAGGGGAGTTATAGCAGACTATACAGCGGTTGGAAGCGTTGGCGTCGTCACGAA CAAAGGCGGTCTCGTGCACCCAGAGGCGACCGACGAGGAGCTTGAGTGGCTGAGCGACCTCTTCAAGGTCGATGTATACG TCGGAACCGCCAACATGGGCGTCCCATTCGTCGGATCGTGTATGATAGCCAACTCGTACGGCGTCGTCGTCGGACACCTG ACGACAGGCCCCGAGATAGTGAAGATTGAAGAAGCTTTGGGCTTCCTCGGATAAAGCTTAAAAGTTCGCCTTCAAAGGCC CGCTGAAGGAGGGATGGAA atggaggtcaaggtctaccgcgttaagggaatcttccagaggggtaagctcaagcagccc ttcaccaaggagtaccgtgctcttaagccggagcacgtcgaggagcttgtctactccgagatagggagcaagcaccgcgt tccgaggaccaagatatggattgagagcatcgaagagataaagccagaagaggctgagaacccggtcgttagaaggctca gccttgagctt TGATTTTTATTCCCCCTACGATAGCTTTTTAAATGGCATTTCTTACTAACTTCTGTGGTTATCATGGA CGGGGAGGGTCTCTACTACTCCGGCAGGGTTCTCTGGGTCGTGAAATCCGGCAATCGACTCTACGGTAAGGTCCTTGATG ACTATCCCTATTATGTTGAAGTTAACGGGGATTCGAGTTTCTGCACGTGTCCCCTGGGCGGCAACTGCGAGCACGTTCGG GCGGTTAAAATAGCGTACGAGAGGGGTTTCTACTTTGACTGTCCCGATGAGGAACCCTTCGGCGAGGGCTGCGCGTATTC AATGTTAAACTCCGTCCCAGAGCTGAGATGGAGAGTGCTCCTCAGGGAGCTTGAGCACGCCCTTGAAACCGATGAGAGCG GAAGCGACGCTGCAAAACTCTTTTATGAGGCTTTTAACATCCTTGGAAAGGATCCAGATGCCAGAAAACTGACGCTGATA GGGGTTCTGTTGAATGAATACTCCGCCCTGTT