tg1688

Coordinates:1591925-1592407

>tg1688 Small heat shock protein, Hsp20 type (Hsp20)
MVWRRDRYWDPFDIMREIQEEIDAIFRDFMRGPRIWSYREPRESIAISESWREPFADIFDRGDKFVITVELPGVRKEDIK
LRVTEDTVYIEAQIRREKELEEEGAIRIERYYSGYRRVIRLPEEVIPEKAKARYNNGVLEIEIPKKNPKKPEGEGFEVKI
E

>tg1688 Small heat shock protein, Hsp20 type (Hsp20)
atggtctggagaagggaccgctactgggacccgttcgatataatgagggaaatccaggaggagattgacgcaatattccg
cgacttcatgaggggcccaagaatctggagctaccgcgagcccagggagagcattgccatcagcgagagctggagagagc
ccttcgcggacatcttcgaccgcggtgacaagtttgtcatcaccgttgagcttccaggagtcaggaaggaggacatcaag
ctccgcgttacagaggacaccgtttacatcgaggcccagataaggcgcgagaaggagctcgaggaggagggcgccataag
aatcgagcgctactacagcggttacaggagggtcatcaggctccccgaggaggtcatcccagagaaggcgaaagcgaggt
acaacaacggcgtcctcgaaatcgagatcccaaagaagaacccaaagaagcccgagggagagggcttcgaggtcaagatc
gag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1591425 - 1592907 (Additional range around tg1688 is :500nt.)

>Thermococcus gammatolerans EJ3 AGTCAAGCCTGAGAAGGTATTCACAGTCTATGGCTTCGCCCGGGAGTTTGCTGAAATTCTCAGGGGACTCGGGCACGAGG CCTTTCCATTACTGCCGAACTCGGAGATTAAGGTTTGAACGCCGTTCAATATGCACCCGCTTTTTCCCGTGAACCTTGAA CATAGAACGAGATCCGAACCGAAACCTTAATATATTCGGAATTCATCAAAATATATCGAAGAACCTTCGCTATTGGGGTC TATTTGTTAGAGAGGTTGCGGGCACGTGGCAGGATCCCCGCGGCCTGAAGGCCTCAGGCGTTTGGGCATCACAGCTGAAA GGGGGTGATACCCAAGCCACCCCTCCCACTTCTATCATCTGTTTCTTCTGAGCCCTAAATCCCGGCCTTCTGGAGACCAT TTTTAGTCACCTTTTGTATGGTAAATCGAAAAGTTTATAAAGGGTTCCTTTTTAGTAACTACTGGTAACCAAAATAAAGG CCGTCGGGAGGTGATGCCCG atggtctggagaagggaccgctactgggacccgttcgatataatgagggaaatccagga ggagattgacgcaatattccgcgacttcatgaggggcccaagaatctggagctaccgcgagcccagggagagcattgcca tcagcgagagctggagagagcccttcgcggacatcttcgaccgcggtgacaagtttgtcatcaccgttgagcttccagga gtcaggaaggaggacatcaagctccgcgttacagaggacaccgtttacatcgaggcccagataaggcgcgagaaggagct cgaggaggagggcgccataagaatcgagcgctactacagcggttacaggagggtcatcaggctccccgaggaggtcatcc cagagaaggcgaaagcgaggtacaacaacggcgtcctcgaaatcgagatcccaaagaagaacccaaagaagcccgaggga gagggcttcgaggtcaagatcgag TGACCCTTTCGTTATTTCCTGCTTTTAACACCGGAGGGGGCTCCACCCCCCTACA ACCCTCAATAAAGCGATATTTCGATAAAATAAACCCGTCACAATCATCGCTCATGAAAAGGAGGTGGTATAGATGAGCGA GAGGAAGGAAATCAAGCTTAAGGTCGCGTCCGCTTACCAGAGGGACGTTGGAAGGGGAATCGTCAGGATTGACAGGAAGG CTATGCGCGAGCTCGGCGTCCAGCCAGGCGACATAGTGGAGATTATCGGAACCAAGAACACCGCCGCCGTTGTCTGGCCC GCCTATCCCGAGGACGAGGGACTCAGCATCATCAGAATGGACGGAACCATAAGGAAGAACGCGGGAGTTGGACTCGGCGA CGAGGTTACTGTCAGAAAGGCCGACGTTAAGGAGGCGAAGAAGGTCATCGTTGCCCCAACCGAGCCGATCAGGTTTGGAA GGGACTTCGTCGAGTGGCTCCACAGCAGGCTCGTCGGCAGACCC