tg1690

Coordinates:1595084-1595326

>tg1690 hypothetical protein TGAM_1690
MIYGVLLSIPEKLVGKYEDQVRRTIGYGIARGDIISFTEARYKGDIAFVMLARSRRAAERTFSELSELPIYVKVIEIEGE
S

>tg1690 hypothetical protein TGAM_1690
atgatctacggagtcctgctcagcatacccgaaaagctggtgggaaaatatgaggatcaggtcaggaggacaatcggtta
cggaatagcgaggggtgatataataagcttcactgaagcccgctacaaaggagatatagcctttgtaatgctcgcccgct
caagaagggccgctgagagaacgttttcagaactctcggagctcccgatctacgtcaaggtcatagagatcgagggcgag
agc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1594584 - 1595826 (Additional range around tg1690 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGCCGGATGAGAAGGCCAGGCTGGAGATATTCAAGGTGCACACCAGGAAGGTTCCGCTGGCGGAGGATGTCAACCTCGA GGAGCTCGCCAAGAGAACCGAGGGCTACACAGGTGCCGACATTGAGGCAGTGGTGAGAGAGGCCGCGATGCTCGCCATGA GGAGGGCGCTCCAGGAGGGCATCATCAGGCCCGGAATGAAGGCCGACGAAATCAGGAGGAAGGTCAAGGTCACCATGAGG GACTTCGAGGAGGCACTGAAGAAGATTGGGCCGTCGGTGAGCAAGGAGACGATGGAGTACTACAGGAAGATACAGGAGCA GTTCAAGCAGTCGCGCGGGTAAACGCGCGACCAGTGAGCGTAAGCTCACGCAGTCTCGTGGATGACCACGAGACCCAGCG AACGAACGTTCGCGCGGGGCGGGCGGCTGACCGCGTGACACCTTCACATTTTTAAATTTTCCTAAGGCTATCGGTAGGCT ATCGGTTTGGAGGTGATGGG atgatctacggagtcctgctcagcatacccgaaaagctggtgggaaaatatgaggatca ggtcaggaggacaatcggttacggaatagcgaggggtgatataataagcttcactgaagcccgctacaaaggagatatag cctttgtaatgctcgcccgctcaagaagggccgctgagagaacgttttcagaactctcggagctcccgatctacgtcaag gtcatagagatcgagggcgagagc TGATTCTTTAACTTTTTGCCCGGTGAGAAATGGCAAAGGGGAGGAGGGGAGGAGC GTCATGCTATGAGCTCGACCTCGTATGCTATAGCGTTGAACTCACTCATCTTCTCCCTCGCTATCCTCTCGGCCTTTTTG ATATCGTTCGCGGGGATAACGATCTCCCAAGGCATCTCTTTCTCCCGATAGTAGAGTATTCTCGCAAGCATGCCATCACC CCCTCTGTATCACTCGGCGTGAAAAGCACTGGAGTTCAATTTAAAAGCTTTGCTGAACATCATTGAACACCAACGAACAG AATTCGGAGAACATTAATGAACTGAAAAGACCCCATAGCCGAGGATGTTCAGCGAACGAGAGGGGAAAGGAGAAGGAATA AGAAAGGGACGCAGAACTAATTCAATCGAGCCTTTCTAGTTCAAAAACCCTGGCGTTTTTAGCTTTAAGCTCCTTTACCG CGATCCTGCGGGCGAGATCGGCGTTTTCAGCCTCAAATGTTATC