tg1714

Coordinates:1619811-1620329

>tg1714 hypothetical protein TGAM_1714
MANLRKFFEKFAGWTRGQILKVHHYVLFQVVEMRIVGFAGALIVIFALFMPWFHSTMLGYESVSFYKMAESTYSNLDEFL
KTFQYLAEHDESGKTTSFLGMYFLGVLFITLGALIGLTGGRGGHILGLIGMALFTAAWYMVFRDHLFDITDTGYYLSWVG
FLIGAIGGGGGKK

>tg1714 hypothetical protein TGAM_1714
ttggcgaatctcagaaaattcttcgaaaagttcgccggctggacacgcgggcaaattttaaaagtgcatcattatgtatt
atttcaggtggtagaaatgcgcatagtggggtttgcaggggcactgatagtgatcttcgccctcttcatgccctggttcc
atagcactatgctgggatacgaatccgtgtccttctacaagatggcggaaagcacctattcaaacctcgatgaattcctg
aagacatttcagtacctggcggagcacgatgagtctggaaaaacgaccagttttctcgggatgtacttcctcggcgtgct
cttcataaccctcggggcactcatcggcctgacggggggcagaggaggccacatcctcggccttataggaatggccctct
tcaccgctgcctggtacatggtgttcagggatcacctctttgatatcacggacacgggctactatctctcctgggtcggc
ttcctgattggggccatcggtgggggtggaggaaagaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1619311 - 1620829 (Additional range around tg1714 is :500nt.)

>Thermococcus gammatolerans EJ3 AAACGCGCGTCCTGTCCGTTATTGGCCTCATTGTGTTTCCCACTATTATCGTGTTAGCGTAGTCATCGAAAAATATGAGA ACCCCAAGCAACCAGCCCATTAACGAGGCTCCCCTGCTCGAGCGAACCCTCCCAGCTAAAGCCCTCCCAATGGCCAGGGC ACCCCCGGATTTATAGACGAGTCCAACTCCCGCACCGATCAGAAAGTCAAAGAGCAGGATTTTGGCGTTCCAGTCGTCGG TTGCACTGGCCACGATCCAGTCCAGGGTCTGGGTTGTTCCGGTTATCGGATTCCACCCGGATAACATCCACCCCCCTACC CATACTCCTGCGAACAGGGCCAGCACGACCCTTTTTGTCCATATGGCCAGTATGATGGCCACAAGCGGTGGGAGCAGTGA CAGCACGCCAAATTCAGGCATTTAACTCACCTCCAGTTGGTTCGTGATCCCAAGGATTTCGAGTAGGTATATAAGCCTTT TGTAAATTTCTTCGACAAA ttggcgaatctcagaaaattcttcgaaaagttcgccggctggacacgcgggcaaatttta aaagtgcatcattatgtattatttcaggtggtagaaatgcgcatagtggggtttgcaggggcactgatagtgatcttcgc cctcttcatgccctggttccatagcactatgctgggatacgaatccgtgtccttctacaagatggcggaaagcacctatt caaacctcgatgaattcctgaagacatttcagtacctggcggagcacgatgagtctggaaaaacgaccagttttctcggg atgtacttcctcggcgtgctcttcataaccctcggggcactcatcggcctgacggggggcagaggaggccacatcctcgg ccttataggaatggccctcttcaccgctgcctggtacatggtgttcagggatcacctctttgatatcacggacacgggct actatctctcctgggtcggcttcctgattggggccatcggtgggggtggaggaaagaaa TAATCACCCTACCACCTCCA CTATTTCTCCCCCTCCCGGCGGAAGAATCGCATTCAAATCCTCCTCGCGAACCTTGTAGCCCCACTTTTCGAGGATTCCG CGTATCTTCTTGACGAGCTCGCCCTTCTTGAGCCTGCCGGGTCTTATGACAATGTACTTGCTCGTGTGGGCCTTAATCGC GTCAACGGGCGCGCAGACGACGTAGTCTTCTCCCTCGTAGTTTATAACTCCCACCGCCAGCTTGAGCGGAAGTCCTCTCA ACCAGTTCCTCTTTCCGTAGACCATGAAGGCACCTTTGCCGAGGTACTCACCGCTGGGAGCTTGCTTAGTCACCTGATTT GGATACGCCCAGTAGGCGTCCGCTCCATACAGCCCCTGACTCCAGGCGCGGCTCATCGAGACCGCGAACTGGCAGGCCTC GAATATCGTCTTCTCTCCAGCCTTCTGCCCGTCCTTGATGACGACGTGCGGAGCACCGTAAACGTCGGCGTGGCAGTAGA