tg1723

Coordinates:1630955-1631710

>tg1723 hypothetical protein TGAM_1723
MRVAVITENARAYYLIVKTLKAYGIGFYSLRPGEKIPFDVEVVLVDEASWEKVNFPSKILVKDGGFVDELLAFLEGREKF
RRIFIAIDPGERPGVSVVADNRVLEVHRMRNPRDVSIVLELLEKYPGARIKIGHGARRQRTLTLKALGQALGYDYRVILV
NEARTTPRVGNTEAPGVQDIVASINIGLREGRETTIGELLEVREPTKREIEDIKRRSRELSGNITISTRLAREVALGNMT
LEEAIERQRRKK

>tg1723 hypothetical protein TGAM_1723
atgagggttgcggtcatcacggagaacgcgagggcctattacctgatcgtgaagaccctcaaggcctacgggatagggtt
ctacagcctcaggccaggtgagaagatccccttcgacgttgaggtcgtcctcgttgatgaggccagctgggagaaggtga
attttccttccaaaatcctcgtgaaggacgggggttttgtagacgagctccttgcgtttcttgagggcagggaaaagttc
aggaggattttcatcgccatagacccaggggagaggcccggtgtcagcgtcgtggccgacaaccgggttcttgaagttca
caggatgagaaacccgagggatgtttccatagttcttgagctcctcgaaaagtaccctggggcgagaataaagataggtc
acggtgctaggaggcagagaacgctcacccttaaggctctcggccaggccctcggctacgactaccgcgttatactcgtg
aacgaggcgagaactacaccaagggtcgggaacaccgaggcccccggagttcaggacatagttgcctcgataaacatcgg
cctcagggaggggagagagaccaccattggcgagctgcttgaggtcagggagccaacaaagcgcgagatagaggacatca
aaaggaggagcagggagctgagcggcaacataaccatatccacgaggctcgcgagggaagtggccctcggaaacatgacg
ctcgaagaggctatagagcggcagaggcggaaaaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1630455 - 1632210 (Additional range around tg1723 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGAGCCTGACAAACTTGCTTTTCTCTCTCCAAAGATAGGAGACCCCTTGAGGAGGTTGCTCGTCCTGCGGGAGGTTGCG GTGAGGGGACTGCTCGACAGAAATCTTGCGGAGACAGTCCTGCTACCGGAGAGCGATTACCTCCTTGCCCGCCTCCTCAA GTTCCTCGCCTTTGAGATGCTGGGGGAGGCAAAGAAGAAAAACGATCCGGAACTTTTGGGTAAGTCCCGCAGGGTATTTG AGATGGGTGTAAAAATCCAGAGGGAATTCGAGGAGAGGCTTTTCTACCAGTCTTCATCCTCCTCCCAGTCCTCGTCCTCC CACTCTTCTTCCCAGTCCTCTTCCTCGAAGTCGTCCTCCTCCCAGAGCTCCTCCTCGAGATAATCCTCATCGTCTTCGAC TTTAACCTTCTTTTTGGGTGGGGACATGGAACCTACCTCACACATATTTGGGGGTGAAAGATTTAAGACTTTTCCCCGAC ATCCTGGCAGGGGTTAGGG atgagggttgcggtcatcacggagaacgcgagggcctattacctgatcgtgaagaccctc aaggcctacgggatagggttctacagcctcaggccaggtgagaagatccccttcgacgttgaggtcgtcctcgttgatga ggccagctgggagaaggtgaattttccttccaaaatcctcgtgaaggacgggggttttgtagacgagctccttgcgtttc ttgagggcagggaaaagttcaggaggattttcatcgccatagacccaggggagaggcccggtgtcagcgtcgtggccgac aaccgggttcttgaagttcacaggatgagaaacccgagggatgtttccatagttcttgagctcctcgaaaagtaccctgg ggcgagaataaagataggtcacggtgctaggaggcagagaacgctcacccttaaggctctcggccaggccctcggctacg actaccgcgttatactcgtgaacgaggcgagaactacaccaagggtcgggaacaccgaggcccccggagttcaggacata gttgcctcgataaacatcggcctcagggaggggagagagaccaccattggcgagctgcttgaggtcagggagccaacaaa gcgcgagatagaggacatcaaaaggaggagcagggagctgagcggcaacataaccatatccacgaggctcgcgagggaag tggccctcggaaacatgacgctcgaagaggctatagagcggcagaggcggaaaaag TAGCGGAGGAGTTTTATACCCTT GCGTCGTAGGATCATCGTCGTGAAAAAGCATTGGAGGTGCGAGCTGTGATCTTTGGGAGAGGCGAGGAGAACGTGGAGGA AATAAAGCTCAGGGTTGCAGAGGCCCTGAAGGTGGACGTTGGCAGGGGGATAGTGAGGTTCGACAAGCAGTACCAGCGGA AGCTCGGCGTATCCACCGGGGACATAGTCGAGCTCATAGGTTCGCGCTCAACCGCCGCGATAGTGGCTAACGCTCACCCG GACGACAGGGGCCTCGACATCATTAGGATGGACGGCTACATCAGAAAGAACGCGGGGGTTAGCATAGGCGACTACGTGAC GGTCAGGAAGGCCCAGGTTCAGGAGGCGAAGAAAGTTGTCCTGGCCCCGGCCCAGAAGGGGGTCATACTTCAGATACCTG GGGACATAGTCAAGCAGAACCTACTTGGGAGGCCCGTTGTGAAGGGGGACATAATAGTCGCGAGCAGCAGGGGTGAG