tg1729

Coordinates:1636413-1637195

>tg1729 Aspartate/glutamate/uridylate kinase, Fosfomycin resistance kinase FomA-like protein (fomA)
MIIVKIGGSVFSDKDGEPENFDHETVRGLAEEIGRFYPAERFLIVHGGGSFGHHYAKKYGIREGLPEDFDVARERMIGFT
RTHQAMLRANNNFLDHFLEVGIPAFPVATSSVFITENGEVAYGDVEVIKKLLKLRFVPVLFGDVSVDLAKGIDILSGDQI
ITYLAKMLNPKKVIFLMDVDGIYDGKPGEGRLLQNISVDEIDSLLERLDCSAKDVTGGICNKLREAKKIARFSEVWFVNG
KIPGRLEGAIRGDGFGTRIVH

>tg1729 Aspartate/glutamate/uridylate kinase, Fosfomycin resistance kinase FomA-like protein (fomA)
gtgataatagtcaagatcgggggtagcgtcttcagcgacaaggatggcgagccggagaacttcgaccacgaaaccgtgag
agggctcgcagaggaaatcgggaggttctacccggcggagagatttttgatagttcacggcggcgggagcttcggccatc
actacgccaagaaatacgggatccgcgagggccttccggaggacttcgatgtagcgagggagaggatgataggattcacg
agaacccaccaggcaatgctcagggccaacaacaacttcctcgatcattttctggaggttggcattccagctttcccggt
agccacatcttccgtcttcataaccgagaacggggaggtcgcctacggtgacgtggaggtcataaagaagctcctcaagc
tgaggttcgttccggttttattcggcgatgtctcggtcgacctggcgaagggcatagacatcctctcgggcgaccagata
ataacttacctcgccaagatgctcaatccgaagaaggttattttcctcatggacgtcgacgggatctacgatgggaaacc
gggggagggacggctcttgcagaacatcagcgtggatgagattgactcactcctggaaagactggattgctcggcgaagg
acgtcaccggcgggatctgcaacaagctcagggaggcaaagaagatcgcccgcttttccgaggtctggttcgtgaacgga
aaaataccgggaaggctggagggggcgatacggggagacggatttgggacgaggattgtacat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1635913 - 1637695 (Additional range around tg1729 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTGGCTTCATCCACTACGAGAAGGGCAAGTTCGAGCCTCTACCCTTCATGGAGCTTCCAATCGTTGTGGGTTACACGGG CTCAAGCGGTTCAACGAAGGAGCTCGTCGCAATGGTGAGGAGAACGAGGGAGGAGATGCCCGAGATAATAGAGCCGATAC TCCTCTCGATGGGTAAAGTGGTGGAGAAAGCGAAGGAGATCTTACTATCCGACCTTGAGGAGAAGATTCGCTTCGAGAGG CTTGGAAAGCTGATGAACATTAATCACGGTCTCCTCGATGCCCTCGGCGTTTCCACCAAGAAGCTCAGCGAGCTGGTTTA TGCAGCCAGAACCGCGGGGGCTCTTGGAGCCAAGATAACCGGGGCCGGGGGAGGTGGCTGTATGTACGCTCTCGCGCCTG AGAAGCAGAGCGAAGTGGCAACGGCCATAACGATAGCCGGCGGAACGCCGATGATAACCGAGATAAGCAAAGAGGGCCTC AGAATAGAGGAGGTGATTCC gtgataatagtcaagatcgggggtagcgtcttcagcgacaaggatggcgagccggagaa cttcgaccacgaaaccgtgagagggctcgcagaggaaatcgggaggttctacccggcggagagatttttgatagttcacg gcggcgggagcttcggccatcactacgccaagaaatacgggatccgcgagggccttccggaggacttcgatgtagcgagg gagaggatgataggattcacgagaacccaccaggcaatgctcagggccaacaacaacttcctcgatcattttctggaggt tggcattccagctttcccggtagccacatcttccgtcttcataaccgagaacggggaggtcgcctacggtgacgtggagg tcataaagaagctcctcaagctgaggttcgttccggttttattcggcgatgtctcggtcgacctggcgaagggcatagac atcctctcgggcgaccagataataacttacctcgccaagatgctcaatccgaagaaggttattttcctcatggacgtcga cgggatctacgatgggaaaccgggggagggacggctcttgcagaacatcagcgtggatgagattgactcactcctggaaa gactggattgctcggcgaaggacgtcaccggcgggatctgcaacaagctcagggaggcaaagaagatcgcccgcttttcc gaggtctggttcgtgaacggaaaaataccgggaaggctggagggggcgatacggggagacggatttgggacgaggattgt acat TAGCTGGGACGAAATCCTTTTATTTTTCTTGACGTTGATAACTTTGATGACCATGTTGCGTAAGACTTTAGCCTT TATGGTGCTCTTTATCCTCGCTTTCTGGGGGCTTCAGAAGGCATCTTCCGGTGGCTACCTGAGTGCTTTCGACGCATCCC CTGATAACCTGAACCTAAGCGTTCAGTCTAAGGACAACACCGTTATTGTTAAATGGGAGCTTCAAGGCGGAAGCATAGTT AGAACTCTCGCCGGCGGAAGGGACGCGGTTATTCTGGTTTATCCCGGCTGGGTGGAGGACAATGATTCGTGGCTTGTGCT GGGTGATGCCGAAAACCTGTCCGTGGCATTGAACGGTGAAAGCCCGAGGAATCTCACGATTATTTACCACCCGTTCCAGG TCTTGGTTTCCAACGGGAGCGCTCAGGCTAAATTGAGAGTCTTTGTAGTTCCCATCGATTTTCCGTCAACGGTTCAGTCC GGAAAAATCGAACTTAAACTGGTA