tg1762

Coordinates:1701588-1702391

>tg1762 Replication factor A complex, RPA32 subunit
MKKRLPASRVYLKDVIEGYYVKSDGDLEPNYLITKDARKVYRVKVVATVVREPFLSDDETYGKFQIDDGTGTIWVLAFRD
NTRFVKLVKKGDLVQVIGKVAEWRDDKQILVEGVAKVHPNMMVLHRFETLKEKAEHVRKARIAFDIYDRYGITAKAKVIA
KNKGVSEDLLMTIDELYTLMLEQRSMELEEELFEEVEEEEKPAENPELEKAKEAVMKLLREKGKPLSHKFIVKKLSKEFE
EETVEEAITRLLAEGEIYEPETGYYEPL

>tg1762 Replication factor A complex, RPA32 subunit
atgaagaagagacttcccgcgagcagggtctacctcaaggacgtcatcgaaggctactacgtcaagagcgacggtgacct
cgagcccaactacctcatcaccaaggacgccagaaaggtctaccgcgtcaaggtggtcgccaccgtcgtgagggagccct
tcctgagcgacgacgaaacctatggcaagttccagatcgacgacgggactggaacgatatgggttctcgccttcagggac
aacactcgctttgtaaagctcgtcaagaagggcgatctcgttcaggtcatcgggaaagttgctgagtggcgcgacgacaa
gcagatactcgtcgaaggcgtcgccaaggtgcacccgaacatgatggtgctccaccgcttcgagaccctcaaggagaaag
cggagcacgttcgcaaagcccggatagccttcgacatctacgaccgctacggcataacggccaaggccaaggtcatagca
aagaacaagggggtaagcgaggacctcctcatgacgatcgacgagctgtacacgctcatgctcgaacagaggagcatgga
gctcgaggaggaactctttgaggaagtcgaggaagaggagaaacctgcagagaatcccgagcttgaaaaggccaaagagg
ccgttatgaagctcctcagggagaaaggaaagcccctctcacacaagttcatagtgaagaagctctccaaggagttcgag
gaggaaacggtcgaggaggcaataaccaggctccttgcggaaggggaaatatacgagccggagaccggctactacgaacc
cctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1701088 - 1702891 (Additional range around tg1762 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTCTTCGGACTGATGCTCAAGGCATTCACGTGGGACGATCTCGACTTCAAGCGCGAGATAGCGATGGAGCGGGCCCAGC TGAGGGAGGCCCTCAAAATGCTCGAAGGTAGCGAGAGGTGAGGTAGATGGAAGCCGAAACCCGTTTCAGGAGGAGGAAAC CCGCCGTTGAGAGGAAGATAGCCGAGATACGCGAGGACGATACGAGAGTCTCGCTCATCGGAAAGGCCTTCAAGGTGGAC AGGATGGACTACACCTTCTGGCTCGACGACGGAACGGGCGTCATACTCATCGAAAGCGAGGACAACGTCCTGCCGGAGAA CGGCCAGCTCGTCAGGGTCATAGGCAGGGTAATCAGGGACGAGAGCGTCCACATCTACGGTGAGGTAATTCAGGACTTCA CAGGCGTCGATCTCGAGGCACTCGAAGAGATAAGGGAGCTTGAGAGGAAGTACCTCCCCAGGATAGAGGAGATGGCCAGC TTCTTCGGGGGTGAGGAGGA atgaagaagagacttcccgcgagcagggtctacctcaaggacgtcatcgaaggctacta cgtcaagagcgacggtgacctcgagcccaactacctcatcaccaaggacgccagaaaggtctaccgcgtcaaggtggtcg ccaccgtcgtgagggagcccttcctgagcgacgacgaaacctatggcaagttccagatcgacgacgggactggaacgata tgggttctcgccttcagggacaacactcgctttgtaaagctcgtcaagaagggcgatctcgttcaggtcatcgggaaagt tgctgagtggcgcgacgacaagcagatactcgtcgaaggcgtcgccaaggtgcacccgaacatgatggtgctccaccgct tcgagaccctcaaggagaaagcggagcacgttcgcaaagcccggatagccttcgacatctacgaccgctacggcataacg gccaaggccaaggtcatagcaaagaacaagggggtaagcgaggacctcctcatgacgatcgacgagctgtacacgctcat gctcgaacagaggagcatggagctcgaggaggaactctttgaggaagtcgaggaagaggagaaacctgcagagaatcccg agcttgaaaaggccaaagaggccgttatgaagctcctcagggagaaaggaaagcccctctcacacaagttcatagtgaag aagctctccaaggagttcgaggaggaaacggtcgaggaggcaataaccaggctccttgcggaaggggaaatatacgagcc ggagaccggctactacgaacccctc TGACCCCGGCCGAATCTTGGCTTTTTTCCTTTCTTGATCAATACTGCTCGCGCA TCGTCCTTATGACGGGATCGTGAATCAGCGTTGAGGTTATGCTGTTCACCATCCGGAAGAACTCGTCTCTGCCCTTCTCA AGCCCCATGTTCTCGATCTTTATGAGCTTGCACTCCTTTCCAAGAACCCACTTGCCGAGGATTATCTTCTCCCTCCCTTC CTTGACCGCATCTATTCTGACTAGTCCGTAGGGTATGTCCGCTGTCCACCAGTTTGCCTTGAAGGTTATCTTCCATCCGG CGCTCCTGATGACTTCGGCCAGCTTTTTCATGGTCTCTCCGGGCCCATAGGGCGTTTTAAAGGTGACGACCGTCCAGAGG CCGTCTTCATCAAGCTTTCTAATTATCTCGTCCTTAAACTCCATAATATCACCTCACATCAAAGCGGCTATCAGGAATGC GAAAACCGCAAGGAAAATGCTCGCCTTGAGCAGTAGCTGTGACCT