tg1766

Coordinates:1704910-1705368

>tg1766 Transcription regulator, asnC/Crp family
MERNSLTSRQLKLLKKLYEEGRPLEVHTVEKTQDELAKELGITRQALSNHLKVLKELGYIRTGRGFIDLTEKALELLGEK
KGDVFIFVRIEPTKRRQVYENVRKLKIKRIYRVTGDIDLIIEADKSKLDEVLEEIASLDGVKETITHVVLEVL

>tg1766 Transcription regulator, asnC/Crp family
atggaaaggaattccctaacgagcaggcaactgaagcttctcaagaaactctacgaggagggcaggcccctagaagttca
cacagtcgagaaaacgcaggacgaactggcgaaagaactcggcatcacaaggcaggccctcagcaaccacctcaaggtcc
tcaaggagctcgggtacataaggacgggcagggggttcatagacctcacggagaaggcccttgagctcctcggggagaag
aagggcgatgttttcatattcgtgaggatagagccaaccaagaggagacaggtatacgagaacgtgaggaagctcaagat
aaagaggatctatcgcgtcaccggcgacatagacctcataatagaggcggacaagagcaaactggacgaggtactggagg
aaatagcgtcgctcgatggagtaaaggagacgataacccacgtcgttctcgaagttcta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1704410 - 1705868 (Additional range around tg1766 is :500nt.)

>Thermococcus gammatolerans EJ3 CATCGACGAGCCTCTTCACACCAACGACCGTTTCCCCTATGTACTGGGAGGGCGTGGTTATTCCTATGAAGTAGTGCAGA TAGGGCTCGATCTCGGAGAGGCTGGGAAAGTTCTCCTCCGCTATACCGAGACTCACGGTGGCGGGGGGGAGTATTCCCTT CTGGCCCAGATCGCTGTCGACTATGCCAACCCGATAGCCGAGGTTCACGAGTTCATTGGCGACGAAGGTTAGGGAAGTCG TTTTACCACTGTCCACGTCACCGATGAACATGACAACGGGCTTTTCAAGGCTAGCTATCATCTCCACGAGCTCAACCCTG TCTTCTGGCACGTCGGTGGTGTAGATAGCCTTGTTTGAGCCCACACCTTCCATACTCTTCCCCCGCTGGAGTTGTGGGAA AGCCTTATAAAAGTCTCTGCCCCTTAAATTAATGTTAGGCTTGACAAAATAAAACCAAAATCACTAATTGAGTCAAGTTT CACGGGGCGGAGGTGGAAAG atggaaaggaattccctaacgagcaggcaactgaagcttctcaagaaactctacgagga gggcaggcccctagaagttcacacagtcgagaaaacgcaggacgaactggcgaaagaactcggcatcacaaggcaggccc tcagcaaccacctcaaggtcctcaaggagctcgggtacataaggacgggcagggggttcatagacctcacggagaaggcc cttgagctcctcggggagaagaagggcgatgttttcatattcgtgaggatagagccaaccaagaggagacaggtatacga gaacgtgaggaagctcaagataaagaggatctatcgcgtcaccggcgacatagacctcataatagaggcggacaagagca aactggacgaggtactggaggaaatagcgtcgctcgatggagtaaaggagacgataacccacgtcgttctcgaagttcta TGACCTCAATTTCTTTTCTATGAGTCTCTTTAACTCCTCAATGTTCTTTCCGAACTTGGCCGAGATCGGGACGAACGTC TCGGGCACCTCATCGAGGGGAACGCCAAACTTCTGAGCCAGGTAGTGGATTACCCGCTGGACGTTCTTCACCCGGTCAAT CTTGTTGACCGCGACGATGGTCGGTATCTCAAGCTCCCGAAGGAACTGGAAGAACTCAACGTCTACAGGTATCTCCCCCC TCTTCTCCCACCGTTCTATTATCTCCGGTGCGGCCTTACCATCGACGACGAGAACGGCGAGATCAATTTTATCGGCGTTG TCCTCTATAAAGTGAACTATCTCGTCCTTAATCCTCTCCTGAACCTGCCGCGGGAGGCCGCTCATAAAACCGAAACCGGG CATATCAATGACCCTCCTGTTGCGCCACACGACCTCAACTGGCTTTCTCGTTACACCGGGCCTCTTTCCCCTCTTCACTT TCTTCCCGGTGAGCCTGAAT