tg1770

Coordinates:1707959-1708663

>tg1770 Phosphosugar mutase
MELYYSEKFNPEELALLGRAIGTVAHGTTIVGRDGRALSRYGKRAMVVGIVSTGSTIMDVRLIPLIALKDFAHKKGLPLA
YVYYYGGVRVEVSGLDVDEIKTILDSRSFIEAHPSDIGATVYYPNALDDFMNDLLKKYRFKMEKRVLVDAMNTPAVLFFP
RLSEALGMEVDIINDMMTSYLPPKPKEVFLHKLRKENYDLGLRFRPDGVVEVHANGEELEFGSMWTLLEHLKKNL

>tg1770 Phosphosugar mutase
atggagctttattattccgaaaagttcaatccagaggagctggctcttctagggagggccatcggaaccgtcgcccacgg
gacgacgatagtggggagagatgggagagcgctctcgaggtacggcaagagggcgatggtggttggcatagtcagtacag
gatcgactataatggacgttcgcctcattcccttaatagcgctcaaggacttcgcccacaagaagggtcttccactggcc
tatgtgtactactacggaggggtacgcgttgaagtaagcggtcttgacgtcgatgagataaagaccatccttgacagcag
gagctttattgaggcccatccaagcgacatcggggcgaccgtttactatcccaacgccctcgacgactttatgaacgatc
tgctcaagaagtacaggtttaagatggagaagagggttctcgtggacgccatgaacacaccggcggttctcttcttcccg
agactctcggaggcccttggaatggaggttgacataataaacgacatgatgaccagctacctgcctccaaaacctaagga
ggtgttcctccacaagctcaggaaagagaactatgacctcggcctgaggttccggccggatggtgtagttgaggtgcacg
ctaacggtgaagagctcgagttcggtagcatgtggaccctcctcgagcacctgaagaagaacctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1707459 - 1709163 (Additional range around tg1770 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTCGTCGCGGTCCTTGGTGTTGAGGAAGGGAATCTCCTTTCCGCCGGGGACGAGGAGCTTGGTGTTGGCCTTGTCCCTC GCCTGGTCGTAGTAGTTGTCGTAGTGGACGGTGTGGTTTGGCGTTTCGAGCATCTTCTCCTCGCCGTAGTAGAGGGCCTT CCAGCGGACGTACTGCTCGTCCTCTTCGCTGTCGGTGCAGACGAAAACCTTGCCCGGCTCGAGCCACTCAATCCACTCCG CCAAAAAAGCGTGAAGCTCGGGGTTGTCGATTGCCTTAACCTTCTCAAACTGCTCCTCTGGAAGGAGTTCCCTAAGCTTT TCAAGGGCGTCCATTTTTGTCGCCTCCTTCACCCACTTGACCAGTGTATTAAAATAGTTTGCCGGCGAGGTTAAGTACTC CGAAGAATATTTAAGGACATCAACCAACAGGTTTTACTGTATTGGCCTGGGAAAACCTTGAAAAGCTGTAACACTCACAG TGATACAGGAGGTGGTGTC atggagctttattattccgaaaagttcaatccagaggagctggctcttctagggagggcc atcggaaccgtcgcccacgggacgacgatagtggggagagatgggagagcgctctcgaggtacggcaagagggcgatggt ggttggcatagtcagtacaggatcgactataatggacgttcgcctcattcccttaatagcgctcaaggacttcgcccaca agaagggtcttccactggcctatgtgtactactacggaggggtacgcgttgaagtaagcggtcttgacgtcgatgagata aagaccatccttgacagcaggagctttattgaggcccatccaagcgacatcggggcgaccgtttactatcccaacgccct cgacgactttatgaacgatctgctcaagaagtacaggtttaagatggagaagagggttctcgtggacgccatgaacacac cggcggttctcttcttcccgagactctcggaggcccttggaatggaggttgacataataaacgacatgatgaccagctac ctgcctccaaaacctaaggaggtgttcctccacaagctcaggaaagagaactatgacctcggcctgaggttccggccgga tggtgtagttgaggtgcacgctaacggtgaagagctcgagttcggtagcatgtggaccctcctcgagcacctgaagaaga acctt TGAGTTTTTCCTTCATGACAACCATTAAAAACCACACCCCCCACTTACTTCCGTTCTGGAGGTGAAAGCAGTGG GTATATTCGTGGTCATTGAGGGCATCGATGGCGCCGGTAAGTCAACGCAGGCAAAGCTGCTAGCAAAGTGGTTTGAAAAA AAAGGATACGAAGTGATCCTCACCAAAGAGCCTACTGACACAGCCTTTGGTAAGCTGATAAGGAAGCTCGTTCTCACAGG GGGGCGGGAGGGTATAATCGACGGGGCTAGAATAAGCCACGAGGCTGAGGCCCTGCTCTTTGCAGCCGATAGGGCTGAAC ATGTTCACAAACTGATAAAGCCAGCCTTGGAATCGGGAAAGGTTGTCATCTCGGACAGGTACTTCTACTCATCCCTCGCA TACCAGTGGGCTAGGGGGCTCGACCTCCAGTGGCTCATAGATCTGAACAGGTTCGCTGTCAGACCTGATCTCGTGGTTCT GCTAGACCTCCCGGTCAAGGAGAGCA