tg1772

Coordinates:1710807-1713284

>tg1772 Alpha-glucan phosphorylase (glgP)
MTYSVEDAIREKLPYPLGELVDLAYNYWWSWNRRATKLWEYIDPEHWRSYKNPVKLLFDTPEERFRELVKDDDFMNLYEL
VIDQFQAYMNPSSTWFSTNYPKWDKPIVYLCMEYGISKSLPIYSGGLGILAGDHVKTASDLGLPFIAVGLLYKHGYFRQE
IDENGNQIEVFPEYRPEEMPIKPVLDRNGERLLIEVPLEDRTVYARAFEVRVGRVKIYLLDTDVPENSPDDRTICDYLYN
AEMDKRIKQEILLGIGGMRLLRALGIEPGVVHLNEGHPAFANLQRIAWLMDEGLTFTEALSVVRGTTVFTTHTPVPAGHD
KFPIEEVRKRLARFLEGREELLELGREGDHLNMTLLAIRTSSYVNGVSKLHAEVSKRMWQGLWPGVPLNEIPIEGITNGV
HTMTWVHNEMRKLFDRYIGKVWREHTNIEGIWYAVERIPDEELWEAHLEAKRQFIELLRRKAIERNQRLGIDDPIPAMDE
NALIIGFARRFATYKRATLILSDLERLKRILNDPERPVYIVFGGKAHPMDEGGKAFLRRVYEVSKMPEFRGKIFIIENYD
MGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNGVLNLSIYDGWWVEGYNGKNGWVIGEESTEPETEEDDPKDAESLY
RILEDEVIPTYYSNRSRWIYMMKESIKSIAPRFSTHRMVKEYMDRFYSKAMSNYIWLTRDNYRGAREIAAWKERVMKAWD
NVEIRDASVEGDNLRVRVYLDGLSPEDVKVELYYGVRARGYEIEKPHIVELRHPTREGDEWVYTYEGSALRHLGDPCWHY
AIRVHPHHEKLPHRFLLGLVKWRGLD

>tg1772 Alpha-glucan phosphorylase (glgP)
ATGACCTATAGCGTTGAGGATGCAATAAGGGAAAAACTCCCATACCCGCTCGGAGAACTCGTCGATCTTGCCTATAACTA
CTGGTGGAGCTGGAACAGAAGGGCCACCAAGCTCTGGGAGTACATAGACCCGGAGCACTGGCGGAGTTATAAGAACCCTG
TTAAACTGCTTTTTGACACTCCAGAAGAGCGATTCAGGGAGCTCGTGAAGGATGATGACTTCATGAACCTCTACGAGCTC
GTTATTGATCAGTTTCAGGCCTACATGAACCCCAGCTCGACTTGGTTCTCGACGAACTACCCCAAGTGGGACAAGCCGAT
CGTCTACCTCTGTATGGAGTACGGCATAAGCAAGAGCCTTCCGATCTATTCCGGCGGCCTCGGAATCTTAGCTGGAGACC
ACGTAAAAACGGCCAGCGACCTTGGGTTGCCCTTCATAGCCGTAGGCCTTCTCTACAAGCACGGCTACTTTAGGCAGGAG
ATAGACGAGAACGGCAACCAGATCGAAGTCTTTCCGGAGTACAGGCCGGAGGAGATGCCGATCAAGCCAGTCCTTGACAG
GAACGGCGAAAGGCTCCTCATAGAGGTCCCCTTAGAAGATAGAACAGTTTACGCAAGGGCCTTTGAGGTTCGGGTCGGCA
GGGTGAAGATTTACCTCCTCGACACGGACGTTCCCGAGAACAGCCCGGACGACAGGACGATATGCGATTATCTCTACAAC
GCCGAGATGGACAAGAGGATAAAGCAGGAGATACTCCTCGGCATCGGCGGGATGAGGCTCCTGAGAGCATTGGGAATAGA
GCCTGGTGTCGTCCACCTCAACGAGGGACATCCTGCCTTCGCGAACCTCCAGAGGATTGCATGGCTTATGGATGAGGGCC
TCACCTTCACCGAGGCGCTGAGCGTCGTCAGGGGGACGACGGTCTTCACAACCCACACGCCCGTCCCTGCAGGCCACGAC
AAATTCCCGATTGAAGAGGTCCGAAAACGGCTCGCCAGGTTCCTTGAAGGTAGAGAAGAACTCCTCGAACTCGGTAGAGA
AGGGGATCATCTCAACATGACCCTCCTCGCAATAAGAACGTCGAGCTACGTGAACGGCGTCAGCAAGCTGCATGCGGAGG
TCAGCAAGAGGATGTGGCAGGGGCTCTGGCCGGGGGTTCCGCTCAACGAGATACCGATCGAGGGCATAACCAACGGAGTT
CACACCATGACATGGGTACATAACGAGATGAGGAAGCTCTTTGACCGCTACATCGGCAAGGTCTGGCGCGAACACACGAA
CATTGAGGGAATATGGTACGCGGTTGAAAGAATACCAGATGAAGAGCTCTGGGAAGCCCACCTTGAGGCCAAGAGGCAGT
TCATCGAGCTACTCAGGAGAAAAGCGATCGAAAGGAACCAGCGGCTCGGCATAGATGACCCAATACCGGCTATGGACGAG
AACGCCCTGATAATAGGTTTCGCGAGGCGCTTCGCCACTTATAAACGCGCCACCCTGATACTCAGTGATCTTGAGAGGCT
GAAGCGCATACTCAACGATCCGGAGAGGCCGGTCTACATAGTCTTCGGCGGAAAGGCCCACCCAATGGATGAGGGCGGTA
AGGCCTTTCTCCGGAGGGTTTACGAGGTCAGTAAAATGCCAGAATTTCGGGGGAAGATCTTCATTATTGAGAACTACGAC
ATGGGTAGCGCGAGGCTCATGGTCGCCGGCGTTGACGTCTGGCTTAACAACCCGCGCAGGCCCCTAGAAGCCAGCGGAAC
GAGCGGAATGAAGGCCGGTCTTAACGGTGTTCTGAACCTGAGCATCTACGACGGCTGGTGGGTTGAAGGCTACAACGGAA
AGAACGGCTGGGTCATCGGTGAGGAAAGCACTGAGCCAGAAACCGAGGAAGACGACCCAAAGGACGCCGAAAGCCTCTAC
CGCATCCTTGAGGATGAGGTAATACCAACCTACTACTCCAACCGTTCCAGGTGGATCTACATGATGAAGGAGAGCATAAA
GAGCATAGCCCCCCGCTTCAGCACCCACAGGATGGTGAAGGAGTACATGGACCGCTTTTACTCCAAGGCCATGAGCAACT
ACATATGGCTCACAAGGGACAACTACAGAGGCGCCAGAGAAATAGCCGCGTGGAAGGAACGAGTGATGAAGGCATGGGAC
AACGTTGAAATAAGGGACGCAAGTGTGGAGGGGGACAACTTGAGGGTCAGGGTTTACCTCGACGGCCTCTCCCCCGAGGA
TGTGAAGGTCGAGCTCTACTATGGAGTCAGGGCTAGGGGTTATGAGATCGAAAAGCCCCACATCGTTGAGCTGAGGCATC
CAACGAGAGAGGGTGATGAGTGGGTCTACACCTACGAGGGAAGTGCCCTGAGGCACCTCGGGGATCCCTGCTGGCACTAC
GCCATCCGCGTGCACCCCCACCACGAGAAGTTGCCCCACAGGTTCCTGCTTGGCCTCGTGAAGTGGAGAGGCCTTGAT


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1710307 - 1713784 (Additional range around tg1772 is :500nt.)

>Thermococcus gammatolerans EJ3 ATTCGCCGTCAACTACTTCCTCCGCGACGAGAACGGCAAGTGGCTCAACCACAAGCTCGATAAAGCGGTATGGCTCAAGT GGATGGAGCTTCGCGTTCACGGCGACGTCGATGCCATCGAGACGCCGATAGGCTACATTCCGAAGTACGAGGATTTGGCA AGGCTCTTCAAGGAGGTTCTCAACAAGGAGTACAGCAGAGAAGACTACGAGAAGCAGTTCACGATAAGGGTTCCAGAACT CCTCGCGAAGATTGAGCGCATAGAGAAAATCTACCGCGAGAAAGTGAAGGAAGTTCCAGAGGAGCTCTTCCAGGTTCTTG AGGAAGAGCGCAGGAGGCTCCTCGAGGCCAGAGAGAAGTACGGGGACTACATCAGCCCGTTCGCATTTGAAAGCGACTGA GTTCTCTTTTCTCCTAATTTATTTTCGTCATCTGCCGAGCGGCAGGGTTTTAAAGGTCGGGACAGCTTAGTATCACTAAG GATGATACACGGTGGTTGCC ATGACCTATAGCGTTGAGGATGCAATAAGGGAAAAACTCCCATACCCGCTCGGAGAACT CGTCGATCTTGCCTATAACTACTGGTGGAGCTGGAACAGAAGGGCCACCAAGCTCTGGGAGTACATAGACCCGGAGCACT GGCGGAGTTATAAGAACCCTGTTAAACTGCTTTTTGACACTCCAGAAGAGCGATTCAGGGAGCTCGTGAAGGATGATGAC TTCATGAACCTCTACGAGCTCGTTATTGATCAGTTTCAGGCCTACATGAACCCCAGCTCGACTTGGTTCTCGACGAACTA CCCCAAGTGGGACAAGCCGATCGTCTACCTCTGTATGGAGTACGGCATAAGCAAGAGCCTTCCGATCTATTCCGGCGGCC TCGGAATCTTAGCTGGAGACCACGTAAAAACGGCCAGCGACCTTGGGTTGCCCTTCATAGCCGTAGGCCTTCTCTACAAG CACGGCTACTTTAGGCAGGAGATAGACGAGAACGGCAACCAGATCGAAGTCTTTCCGGAGTACAGGCCGGAGGAGATGCC GATCAAGCCAGTCCTTGACAGGAACGGCGAAAGGCTCCTCATAGAGGTCCCCTTAGAAGATAGAACAGTTTACGCAAGGG CCTTTGAGGTTCGGGTCGGCAGGGTGAAGATTTACCTCCTCGACACGGACGTTCCCGAGAACAGCCCGGACGACAGGACG ATATGCGATTATCTCTACAACGCCGAGATGGACAAGAGGATAAAGCAGGAGATACTCCTCGGCATCGGCGGGATGAGGCT CCTGAGAGCATTGGGAATAGAGCCTGGTGTCGTCCACCTCAACGAGGGACATCCTGCCTTCGCGAACCTCCAGAGGATTG CATGGCTTATGGATGAGGGCCTCACCTTCACCGAGGCGCTGAGCGTCGTCAGGGGGACGACGGTCTTCACAACCCACACG CCCGTCCCTGCAGGCCACGACAAATTCCCGATTGAAGAGGTCCGAAAACGGCTCGCCAGGTTCCTTGAAGGTAGAGAAGA ACTCCTCGAACTCGGTAGAGAAGGGGATCATCTCAACATGACCCTCCTCGCAATAAGAACGTCGAGCTACGTGAACGGCG TCAGCAAGCTGCATGCGGAGGTCAGCAAGAGGATGTGGCAGGGGCTCTGGCCGGGGGTTCCGCTCAACGAGATACCGATC GAGGGCATAACCAACGGAGTTCACACCATGACATGGGTACATAACGAGATGAGGAAGCTCTTTGACCGCTACATCGGCAA GGTCTGGCGCGAACACACGAACATTGAGGGAATATGGTACGCGGTTGAAAGAATACCAGATGAAGAGCTCTGGGAAGCCC ACCTTGAGGCCAAGAGGCAGTTCATCGAGCTACTCAGGAGAAAAGCGATCGAAAGGAACCAGCGGCTCGGCATAGATGAC CCAATACCGGCTATGGACGAGAACGCCCTGATAATAGGTTTCGCGAGGCGCTTCGCCACTTATAAACGCGCCACCCTGAT ACTCAGTGATCTTGAGAGGCTGAAGCGCATACTCAACGATCCGGAGAGGCCGGTCTACATAGTCTTCGGCGGAAAGGCCC ACCCAATGGATGAGGGCGGTAAGGCCTTTCTCCGGAGGGTTTACGAGGTCAGTAAAATGCCAGAATTTCGGGGGAAGATC TTCATTATTGAGAACTACGACATGGGTAGCGCGAGGCTCATGGTCGCCGGCGTTGACGTCTGGCTTAACAACCCGCGCAG GCCCCTAGAAGCCAGCGGAACGAGCGGAATGAAGGCCGGTCTTAACGGTGTTCTGAACCTGAGCATCTACGACGGCTGGT GGGTTGAAGGCTACAACGGAAAGAACGGCTGGGTCATCGGTGAGGAAAGCACTGAGCCAGAAACCGAGGAAGACGACCCA AAGGACGCCGAAAGCCTCTACCGCATCCTTGAGGATGAGGTAATACCAACCTACTACTCCAACCGTTCCAGGTGGATCTA CATGATGAAGGAGAGCATAAAGAGCATAGCCCCCCGCTTCAGCACCCACAGGATGGTGAAGGAGTACATGGACCGCTTTT ACTCCAAGGCCATGAGCAACTACATATGGCTCACAAGGGACAACTACAGAGGCGCCAGAGAAATAGCCGCGTGGAAGGAA CGAGTGATGAAGGCATGGGACAACGTTGAAATAAGGGACGCAAGTGTGGAGGGGGACAACTTGAGGGTCAGGGTTTACCT CGACGGCCTCTCCCCCGAGGATGTGAAGGTCGAGCTCTACTATGGAGTCAGGGCTAGGGGTTATGAGATCGAAAAGCCCC ACATCGTTGAGCTGAGGCATCCAACGAGAGAGGGTGATGAGTGGGTCTACACCTACGAGGGAAGTGCCCTGAGGCACCTC GGGGATCCCTGCTGGCACTACGCCATCCGCGTGCACCCCCACCACGAGAAGTTGCCCCACAGGTTCCTGCTTGGCCTCGT GAAGTGGAGAGGCCTTGAT TGAGGAAGTCACCTGGGTTACTATTTTACCTTTTTATCCGCTTTGTGGGCATTGCTTTGT TACAAACTGTTTCATTGTGCTGTTCAATTTATGCGATAGGAAAGGCAAGGATTTTAAGTTCAGATGACCCATAAGTTTGA GAAATTTCCAGGGGGTGTCCTGATGGATCAAATTAAAAAGTGGACCCTGTACCTGATGGTGCTGGTAGCAGGTTTCGCGA CTGGAATAGGGACGATAGGACTGTTCCCACAGATGTGGCTGAAATATGGCATCACGGGACTGGCACTCCACGCGGTGTTC TTGGCCATACTGACTTATCTGGCAATCCTCGAGGCGGAGAAGGTCATGAGATCTGGCTACTATTTCACGGAACTGTACAC TAAAGTTTCGAGAAAACCGGGGATGATACTGGCGATTTTCGCGGTCGGTGTGATGTTTCTCTCCTACTACACCGCTAACA CGGGTCTCGTGCTCCTCTCGCCGGTCTTGGGAACTGGAG