tg1774

Coordinates:1713950-1714732

>tg1774 hypothetical protein TGAM_1774
MFLSIAKNMLTARKPISLEMLRAAAERALYGVGLGFGFYLMLGSFINERFNPKLIIGTGVFIQFIIGLLSTLAVIYGVTP
YRPEEFLIYANGGEEQAITLMGDLPEILSNHPMLLAFLGLTIFMAGLTSLLPAAEIGVQITESLMKFGRSKAALYFMGIV
TVLGILDSPPNIADMFLKAVTTSLLLTSIFEAYPIVIGKEKPGAIDLAVLVVSVTLFIAGFIAQVHHDIKLGGIYYASVV
LALFIGLLGIMGEKIVPQGPE

>tg1774 hypothetical protein TGAM_1774
atgtttctgagcatagccaagaacatgctcactgccagaaaaccgatctcccttgagatgcttcgtgcggccgctgagcg
cgccctttacggcgtcggcttgggttttggattctatctaatgctcggtagtttcatcaatgagcgcttcaaccccaagc
tcattattggaaccggtgtcttcatccagttcataataggcctcctctcaacccttgccgttatctacggggttacaccg
tacaggcctgaggagttccttatctacgccaacgggggagaagagcaggcaataacccttatgggggacctgcccgaaat
actctcaaaccacccgatgttgcttgcttttctgggcctgaccatattcatggccggactaaccagcctcctacccgcgg
ccgagatcggggtgcagataacggaatcgcttatgaagttcggcaggtcaaaggcggcactctacttcatgggcatagtt
actgtcctgggaatcctcgactccccgcccaacattgccgatatgttcctcaaggccgttacaacgtccctcctgctcac
gtctatcttcgaagcgtatccgatagtgatcggcaaggaaaaacccggcgcaattgacctagccgttctcgtggtatccg
tgacactcttcattgcggggttcatagcgcaggtgcaccacgacataaagctcggtggcatttactatgcgtcagtagtg
ctcgcactgttcatcggtctgctcggaataatgggagaaaagatagtcccgcagggaccggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1713450 - 1715232 (Additional range around tg1774 is :500nt.)

>Thermococcus gammatolerans EJ3 GATCAAATTAAAAAGTGGACCCTGTACCTGATGGTGCTGGTAGCAGGTTTCGCGACTGGAATAGGGACGATAGGACTGTT CCCACAGATGTGGCTGAAATATGGCATCACGGGACTGGCACTCCACGCGGTGTTCTTGGCCATACTGACTTATCTGGCAA TCCTCGAGGCGGAGAAGGTCATGAGATCTGGCTACTATTTCACGGAACTGTACACTAAAGTTTCGAGAAAACCGGGGATG ATACTGGCGATTTTCGCGGTCGGTGTGATGTTTCTCTCCTACTACACCGCTAACACGGGTCTCGTGCTCCTCTCGCCGGT CTTGGGAACTGGAGCCGTCGGTAGGCTCATTGCAAAACTCATAATGATCGCTTTGACCTTGGTCGTCATAACCCGCGCCA AGGAGAAGACATTCACAATAATGGCCATAGGAGCTTTTATCCTCGTGATCCTCGTTCCCATTCTGGTACTTCTCCTCAAA CCCAGGTTCCCGAGAACGCA atgtttctgagcatagccaagaacatgctcactgccagaaaaccgatctcccttgagat gcttcgtgcggccgctgagcgcgccctttacggcgtcggcttgggttttggattctatctaatgctcggtagtttcatca atgagcgcttcaaccccaagctcattattggaaccggtgtcttcatccagttcataataggcctcctctcaacccttgcc gttatctacggggttacaccgtacaggcctgaggagttccttatctacgccaacgggggagaagagcaggcaataaccct tatgggggacctgcccgaaatactctcaaaccacccgatgttgcttgcttttctgggcctgaccatattcatggccggac taaccagcctcctacccgcggccgagatcggggtgcagataacggaatcgcttatgaagttcggcaggtcaaaggcggca ctctacttcatgggcatagttactgtcctgggaatcctcgactccccgcccaacattgccgatatgttcctcaaggccgt tacaacgtccctcctgctcacgtctatcttcgaagcgtatccgatagtgatcggcaaggaaaaacccggcgcaattgacc tagccgttctcgtggtatccgtgacactcttcattgcggggttcatagcgcaggtgcaccacgacataaagctcggtggc atttactatgcgtcagtagtgctcgcactgttcatcggtctgctcggaataatgggagaaaagatagtcccgcagggacc ggag TGATCACTTGTGGGCAAAGATCGCCCGGACCTTTCCATCTTTTACCTCATCTATTCTCACGAAGCCGAAGCGCTC GAACTGGACGATGTCATCAACCTTAACGTCGGCATCGCTTTCAAGGAGCCCCTTTCTGATGATTAGCTCGTCCCCCTCCG GAACCCAGACCTCGCAGGGCTTGCCCTCAGTGACCCAGTGAACCATCCTCCACCTGTTTTTCTTGGCAGTTTCGTAGTCA ACACTGTGGAACCTCGCCTTAATACCGTCCTCGCCCACCTCAAGGATTTCGACGTTGAAGAGGTCCTTCAGGCGGACGAA GTTCCCCGGCTTGAAGAGCTCCATGTCGTCCCTGGAGACGTAGACAGGCTTTCCTGGGACGAACTTGAGCCTCCTAACGC CCCTCTCCGGATGGTCTGGATGGAGCGGAATCTCGGCAACGAACTCCTTGGCCCCCTCTATGTACATCGGAACCGGGTCA GCGACGAAGAAGTAGCGGTTCGCT