tg1788

Coordinates:1726020-1726238

>tg1788 hypothetical protein TGAM_1788
MSGDGKQYLLDRTLERWKGKRIAVGIGSETSFSGILADFDEEVILLRDVTDYTGNRTKELIAKIDDINWITLL

>tg1788 hypothetical protein TGAM_1788
atgagcggagacggaaagcagtacctccttgacagaactctggagagatggaaggggaagcggattgccgttgggatcgg
cagcgagaccagcttttctggaattctggcggacttcgatgaggaagtaatcctgctgagggacgtgacggactacacag
gaaaccggacgaaggaactcatagcgaaaatcgacgacataaactggataaccctgcta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1725520 - 1726738 (Additional range around tg1788 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCCCTCTGGGTTGGTCACGAGGTTAAAGGGGAACTTGAACTGAAACCTCAGGGTGAGTGGATCAATTCCTTCTTTCAGC TTTAGGAGATTCCCATCGGGATCGTAGTCAAGTGCCCCCGCATTGTACAGCTGATCCAGAACGTCCGCTACCCAAAGACC CTCTGACAGCAGTTTGTCCGCAGATTCCCCACCTTTTAGGTGGTCGAGGATATGATTGATGCTCTCACGGAACGATTCGA ATCCTTCCAATAGGGCTTCCCTGTCAACGCCCTCCATCACGTCGATCTTTGATCTTATTTCTTCAAGCGTTCCCTCCAAG AGGTATCCAACGAAGGTCTCGTGGGACTGCTTCTCAACTACCTTGAAGTCCACTCCTTCCCTCCTCAGGTCAGCGGAAAA AGCTTCTCTTAGAGTGGGGCTTTTTGTTGAGAGTCTCATACCATCACCGCCTCGGTAAAGGCTAAAAAGCCTTATAGACT TTTGGATTTGGGGTGAGAGA atgagcggagacggaaagcagtacctccttgacagaactctggagagatggaaggggaa gcggattgccgttgggatcggcagcgagaccagcttttctggaattctggcggacttcgatgaggaagtaatcctgctga gggacgtgacggactacacaggaaaccggacgaaggaactcatagcgaaaatcgacgacataaactggataaccctgcta TGAGGGATAGCCATGCGCGCGGTTGCCTTCGTTGGCTTTAAAAAAAGCGGTAAGACGACAACCGTTGAGGCGGTTGCTA GAGTCCTCAAGGAACGTGGCTACCGCATTGCAATAGCGAAGAGCATGCACGCGGACTTTGACAGGGAGAACAGCGACACG TGGAGGTTCTCAAAGGTAGCTGACGCCGTTATTGTCAGGGCACACGACACCGATGCACTCCTCTTCAAAGCCAAGGACAT AAACGCGCTCTTCTCGACGGTCTCTGCCGACTTTCTCCTGCTCGAGGGCTTCAAATCAATCCAACATGTCCCCAAGGTGA TTTGCGCAAGAAGCGAGAAAGACGTGAGGGAGCTCAACGACGGCTTAGCCATAGCAGTAAGCGGAGTTATAGCCTCGACC GGTGTTGAAAAGATAGGCGATCTTCCTGTGATTGACGCGACGAAAGAGCCGGAGAGGCTCGCCAATCTGGTTGAGAAAAG GGCATTCATGCTCCCCAACA