tg1789

Coordinates:1726251-1726982

>tg1789 Molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
MRAVAFVGFKKSGKTTTVEAVARVLKERGYRIAIAKSMHADFDRENSDTWRFSKVADAVIVRAHDTDALLFKAKDINALF
STVSADFLLLEGFKSIQHVPKVICARSEKDVRELNDGLAIAVSGVIASTGVEKIGDLPVIDATKEPERLANLVEKRAFML
PNIDCGLCGFRCAEMARMIVRGEKTIKDCVVLSSRPKVTVKIDGQILPMKDWVQELVEKTVKGMLSAMKGYREGRRIEIV
IRDE

>tg1789 Molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
atgcgcgcggttgccttcgttggctttaaaaaaagcggtaagacgacaaccgttgaggcggttgctagagtcctcaagga
acgtggctaccgcattgcaatagcgaagagcatgcacgcggactttgacagggagaacagcgacacgtggaggttctcaa
aggtagctgacgccgttattgtcagggcacacgacaccgatgcactcctcttcaaagccaaggacataaacgcgctcttc
tcgacggtctctgccgactttctcctgctcgagggcttcaaatcaatccaacatgtccccaaggtgatttgcgcaagaag
cgagaaagacgtgagggagctcaacgacggcttagccatagcagtaagcggagttatagcctcgaccggtgttgaaaaga
taggcgatcttcctgtgattgacgcgacgaaagagccggagaggctcgccaatctggttgagaaaagggcattcatgctc
cccaacatcgattgcggcctctgtgggttcagatgtgctgagatggcgaggatgatcgtgaggggtgagaaaacgattaa
agactgtgtcgtcctcagctcgagacccaaggtcacggtcaagatagacggtcagatcctgccaatgaaggactgggttc
aggagctcgtggagaagacggtaaagggcatgctttcagccatgaagggttaccgcgagggcaggaggatagagatagtg
atcagggatgaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1725751 - 1727482 (Additional range around tg1789 is :500nt.)

>Thermococcus gammatolerans EJ3 ACGATTCGAATCCTTCCAATAGGGCTTCCCTGTCAACGCCCTCCATCACGTCGATCTTTGATCTTATTTCTTCAAGCGTT CCCTCCAAGAGGTATCCAACGAAGGTCTCGTGGGACTGCTTCTCAACTACCTTGAAGTCCACTCCTTCCCTCCTCAGGTC AGCGGAAAAAGCTTCTCTTAGAGTGGGGCTTTTTGTTGAGAGTCTCATACCATCACCGCCTCGGTAAAGGCTAAAAAGCC TTATAGACTTTTGGATTTGGGGTGAGAGAATGAGCGGAGACGGAAAGCAGTACCTCCTTGACAGAACTCTGGAGAGATGG AAGGGGAAGCGGATTGCCGTTGGGATCGGCAGCGAGACCAGCTTTTCTGGAATTCTGGCGGACTTCGATGAGGAAGTAAT CCTGCTGAGGGACGTGACGGACTACACAGGAAACCGGACGAAGGAACTCATAGCGAAAATCGACGACATAAACTGGATAA CCCTGCTATGAGGGATAGCC atgcgcgcggttgccttcgttggctttaaaaaaagcggtaagacgacaaccgttgaggc ggttgctagagtcctcaaggaacgtggctaccgcattgcaatagcgaagagcatgcacgcggactttgacagggagaaca gcgacacgtggaggttctcaaaggtagctgacgccgttattgtcagggcacacgacaccgatgcactcctcttcaaagcc aaggacataaacgcgctcttctcgacggtctctgccgactttctcctgctcgagggcttcaaatcaatccaacatgtccc caaggtgatttgcgcaagaagcgagaaagacgtgagggagctcaacgacggcttagccatagcagtaagcggagttatag cctcgaccggtgttgaaaagataggcgatcttcctgtgattgacgcgacgaaagagccggagaggctcgccaatctggtt gagaaaagggcattcatgctccccaacatcgattgcggcctctgtgggttcagatgtgctgagatggcgaggatgatcgt gaggggtgagaaaacgattaaagactgtgtcgtcctcagctcgagacccaaggtcacggtcaagatagacggtcagatcc tgccaatgaaggactgggttcaggagctcgtggagaagacggtaaagggcatgctttcagccatgaagggttaccgcgag ggcaggaggatagagatagtgatcagggatgaa TAAAACAATGAGAATCGTTCAAGACTATGAAGTTCTATGACATTAC AATTTCACAACTTCACTTCTCTCCTTGAGATAAGCAGTTTGAGAGCTGCTCGAACAGGGGAAAATCTTTAACCTTTTCCC CTATAAAGTGTTCGGTGATCATATGGAACGTTATGTCCTTTCACTTGACGAGGGAACTACCTCGGCAAGGGCTATAATCT TCGACAGGGAGAGCAACATCATCGGACTGGGCCAGTACGAGTTCCCCCAACATTACCCCAAGCCAGGCTGGGTTGAGCAC AACCCGGAAGAAATCTGGGACGCGCAGTTCAGGGCCATCAAAACTGCCCTTGAGAGGGCGAAGGTAGAACCGAGCCAGAT AGCGGCGATAGGCGTTACGAACCAGCGAGAAACGACGATAGTTTTCGACCGCGACGGAAAACCGCTCTACAACGCGATAG TCTGGCAGTGCAGGAGAACGGCCGAGATGGTGGAAGAGATAAAGCGCGAATAC