tg1795

Coordinates:1732682-1733488

>tg1795 hypothetical protein TGAM_1795
MVKMRRLLAVLLILGVVMAAGCIGDSVGLTKEKVLNAINSIERGEYTTNASVVLRAVSDELNRTITIEEYIHVTGAFDNR
RNLEKGHIDVRVKYLGIETKISWPYFTNGSNVYFNVEGKWYSMPLDNELTEFANGSLNVDFIEKLLSKKNVEMKRVEGGY
YFKTNVTFEEILNATGREFINTILKDENVMNITTESGYVEVKIRGDGMPYWIHEYLNLIVSIRDPLEGDTDNMYLTINET
TELRNINGDVMITVPKGIEEAKPLDEILG

>tg1795 hypothetical protein TGAM_1795
gtggtaaagatgagaagactcctcgcggtgttgttgatcctcggggtggttatggcagcgggttgcatcggcgacagtgt
aggcctgacaaaagagaaggttctcaacgcaataaacagcatcgagcgcggtgagtacacgacaaacgccagtgttgtcc
tcagggcagtttccgatgaactcaacaggacgataacaatagaggaatacatccatgtaacgggcgcctttgacaacagg
agaaacctagaaaagggtcacatcgacgtccgtgttaaatacctcgggatagagaccaagataagctggccctacttcac
taacggctcgaacgtttacttcaacgtcgagggcaagtggtattccatgccccttgacaacgagctcacggagtttgcca
acggcagtttgaacgtcgactttatcgagaagcttttatcaaagaagaacgtggagatgaagagggttgaagggggttac
tacttcaagaccaacgtcaccttcgaggaaattctcaacgccacgggaagggagtttataaacacgatcctaaaggatga
gaatgtaatgaacataacaaccgagagtggatacgtagaagtaaagataaggggcgatggcatgccatactggatccacg
agtacctgaacctcattgtctcaatcagggatccactcgaaggagacaccgataatatgtacctaacaatcaacgaaacc
acagagctcaggaacataaacggtgacgtcatgatcacagttccaaagggaatagaggaagcaaagcccctcgacgagat
tcttggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1732182 - 1733988 (Additional range around tg1795 is :500nt.)

>Thermococcus gammatolerans EJ3 CTAACCCCCGATATCCTAAGGAGGCTCAACGATCCATATACCTTCGTTAACGACATGAGGAAACACGCCACCACAGTGAA CCTCACAAGAAATGGGAATAGATCAACCCTGATCCTCGAATGGGAAGATAGGGGCGAGTTTGTTAACACGTACTACCGGG TTGTTGCAGTTTATGTGAATGACGAACTAAGGGAGGTCTCGTACGAAACCTCTCACTCCCTCAACTACGACCCCCGCAAC TCCTCCGTTTGTGTCGATTACATCGACGTGCACATAAAGTACAGGGTACAGAAAACTCGTTGCTGGATTAAAGGCATAAT CTGGTGGAAATCCGCACTGAAGAACTACCTCAGGAGCATGGCCGGTGAAGTCGAGAAGCACGGTAATGAACCGTGGTGAA CTTTCCACTTTTTGCACACTATTTACAGTAGTATGCAAAATTTGAATACAAAACATATTTAAAGGCTAGTGCGTTTTTAG TTGTGTAAACTGCACGGAT gtggtaaagatgagaagactcctcgcggtgttgttgatcctcggggtggttatggcagcg ggttgcatcggcgacagtgtaggcctgacaaaagagaaggttctcaacgcaataaacagcatcgagcgcggtgagtacac gacaaacgccagtgttgtcctcagggcagtttccgatgaactcaacaggacgataacaatagaggaatacatccatgtaa cgggcgcctttgacaacaggagaaacctagaaaagggtcacatcgacgtccgtgttaaatacctcgggatagagaccaag ataagctggccctacttcactaacggctcgaacgtttacttcaacgtcgagggcaagtggtattccatgccccttgacaa cgagctcacggagtttgccaacggcagtttgaacgtcgactttatcgagaagcttttatcaaagaagaacgtggagatga agagggttgaagggggttactacttcaagaccaacgtcaccttcgaggaaattctcaacgccacgggaagggagtttata aacacgatcctaaaggatgagaatgtaatgaacataacaaccgagagtggatacgtagaagtaaagataaggggcgatgg catgccatactggatccacgagtacctgaacctcattgtctcaatcagggatccactcgaaggagacaccgataatatgt acctaacaatcaacgaaaccacagagctcaggaacataaacggtgacgtcatgatcacagttccaaagggaatagaggaa gcaaagcccctcgacgagattcttggc TGATTTTTCTTTCCTCTCTTTATAATTTTGCGGGGGTGCAACCGTGAGACGT GCCCTGCTCGCGCTTCTGCTGTCGGCTGTAGTGTTGCTGTCCGGATGTATCTCCAGCGGCTCCGGCAACGAAGGGAAGAG CGCAACTTCCTCAACCCCAACGGTCGAGGAAAAACTCCTGCAGGGCATCGACAATATGACAGAGTACAACCTCTCGATGG TTGAGGGAGTCAATTTCAATCTCTCGGACATAAGCATGCTCCCCACTGACCTCAAGATGGGATTCAGGATCTCCGGTCTC GTCGATGGAAACAAAGGAGTAATCCTTGCGAACGTGTCCCTCGAACCACTCGATCCCTTCGGCATGACCGGACAGAGTTA CATCCTCTACGTTAACGGATCAAATGCCAGACTCAAACCTGTGAACCCTAATGCCTTCCAGGGACTTGGAGAGTTAGTGA CTCCAGACCCTATGGTCTTCAGGGGCTACATAGGGCAGGCCAAGCACA