tg1800

Coordinates:1735954-1736535

>tg1800 LSU ribosomal protein L15E (rpl15E)
MGMYKYIREAWKSPKKSYVGELLKKRMIKWRREPVVVRIERPTRLDRARSLGYQAKQGYVVVRVRVRRGGRKRPRWKGGR
KPSKMGMVKYSPKKSLQWIAEEKAARKFPNLEVLNSYWVGEDGMYKWFEVIMVDPHHPVIKSDPKIAWITGKAHKGRVFR
GLTSAGKKGRGLRNKGKGAEKVRPSVRANKGKTK

>tg1800 LSU ribosomal protein L15E (rpl15E)
atgggaatgtacaagtacataagggaagcctggaagagccccaagaagagctacgtcggggagctcctcaagaagaggat
gataaagtggcgccgtgagcccgttgtcgtgaggattgagaggccgacgaggcttgaccgcgctcgttcgctcggctacc
aagccaagcagggctacgtcgtcgttcgcgttcgcgtcaggcgcggaggaaggaagagacccaggtggaagggaggaagg
aagccgagcaagatgggtatggtcaagtactcgccaaagaagagccttcaatggatagccgaggagaaggcagctagaaa
gttcccgaaccttgaggttctcaactcctactgggtcggcgaggacgggatgtacaagtggtttgaggtcataatggtcg
acccgcaccacccggtcataaagagcgacccgaagatagcctggatcacaggtaaggcccacaagggtagagtatttaga
ggtctcaccagcgccggcaagaagggtcgcggcctgaggaacaagggtaaaggagcggagaaggtcaggcccagcgttag
agctaataagggcaagaccaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1735454 - 1737035 (Additional range around tg1800 is :500nt.)

>Thermococcus gammatolerans EJ3 ACTACGTTCAGGGCAACCTCCTTTCAAACTGTACCGTTGCCTTCACTTACCTCATGCCAGAGCCTGGTAGAGTGGAGGTT TATGAGCTCGACGCGGCAACGTACAAGGCCCTTACCGGGAACGGCACCGGGAAAACCTGCTCGGATGAACTCATAGAAGG GACGCTGAAAGTCCAGTTTGACCAGAAACTTGAGTCCTTATCCATTCAGGTGTGGAACGGCAAACTCTCCGAGGACGGGG CCAACGTCTACTTCAGACTCCTCGGAACGTGGCAGTTCTTCGACAATCTGTCGGCCGTTTACGTTGCACCATCCCCCGAG AAGGACTACAAGCTGGTAACGATTCAAGAGCTCAAGGAAATGATCAAGGAAAACGGGGTGCACCCGCTTGGATGAGCGCA ACCCTTAAAAACCAACCCTCGAAACCCGACCGACTAGGCGGGTTCGCCCGCGGGATGTTCCGCTCTGCGGAGAACCACAA ACAAGGAAGGAGGGTGCAAG atgggaatgtacaagtacataagggaagcctggaagagccccaagaagagctacgtcgg ggagctcctcaagaagaggatgataaagtggcgccgtgagcccgttgtcgtgaggattgagaggccgacgaggcttgacc gcgctcgttcgctcggctaccaagccaagcagggctacgtcgtcgttcgcgttcgcgtcaggcgcggaggaaggaagaga cccaggtggaagggaggaaggaagccgagcaagatgggtatggtcaagtactcgccaaagaagagccttcaatggatagc cgaggagaaggcagctagaaagttcccgaaccttgaggttctcaactcctactgggtcggcgaggacgggatgtacaagt ggtttgaggtcataatggtcgacccgcaccacccggtcataaagagcgacccgaagatagcctggatcacaggtaaggcc cacaagggtagagtatttagaggtctcaccagcgccggcaagaagggtcgcggcctgaggaacaagggtaaaggagcgga gaaggtcaggcccagcgttagagctaataagggcaagaccaag TGATTTTTCTCTCCCCTTTTAAATTAGGTTCACCGC CAAGAGAAGGACGGAGCCAGCCAGAATGAGCGCTTCTTCGAGCCCGAACTTTCCCCTGTAGGGGAGTCTAAGATCCCCCT GGTAACCCCTTGCCTCGATTGCTTCTCCCAACTCGGTTCCAAGGAGAACCGTACCTATGAGCAGGGGAACGATACGAGCT TTAAGGGATGTGAAACTTCCTTTTACTCCCCGCGATGCCTGCGCTTCCGATATTTCACGATAGAGCCTCTCAAGGTTCTG GAGACCGTTGACGACCAGACCCGCCGAGAGAGCAACGTCAGACGGCAGCCTGAGATTCAACAGGGCGCCGGTAAGCTCTC CTGCATCCATCGTCTCGGAGAAGAGGAGGCCCAGTTCCATGAGGGCAAGAAGGCGGAGAAAGTAATCAACGCCTCCCAGG AGACCCACGAGCGAGAACGTGAGAAAACCCGGCGTGAAGGCCTTCCGTTGCATTAGGGGGATG