tg1804

Coordinates:1738663-1739172

>tg1804 Biotin biosynthesis protein, bioY (bioY)
MRPRDIGLISTFTAFTALGAQVAIPIGPVPITLQVLFVLLSGLVLGARLGFLSQTLYLLLGLLGFPVFAHLGSGFAVLYG
PTGGYLLAFPLASFLAGMMSGRGKAIEMAGALLAIGAIYLLGWARLSLLIGPEKAFYLGVLPFVGVDVAKAVVAVLVANA
VREALPEGRF

>tg1804 Biotin biosynthesis protein, bioY (bioY)
atgagaccaagagacatcggcttaatttccactttcacagcgtttacagccttaggtgcccaggttgcgataccaattgg
ccctgttccgataaccctgcaggtgctcttcgttcttctctcaggcctcgttcttggggcacggctcggttttctgagtc
agacgctctacctcctactcgggctgcttggctttccagtcttcgcccacctaggttctggttttgccgttctctacggc
ccgactggaggttacctcctagcgtttcccctcgcttccttcctagccggcatgatgtcaggaaggggaaaagccatcga
aatggccggggctctgcttgcgataggtgcaatctatctcctcggttgggcaaggctctcgcttctaatcggccctgaga
aggccttctacctcggcgtcctgcccttcgtaggtgttgacgttgctaaagcggttgtagcggttcttgtggcgaatgcc
gttagggaggccctaccggagggcaggttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1738163 - 1739672 (Additional range around tg1804 is :500nt.)

>Thermococcus gammatolerans EJ3 CGGAGAGGTCTTCCATCGGAATACCTGGTGATAGCGCGAGTGAGAAGTAGAGACCACCGGGCATGGAAAGCCAGCTTCTC CCGAGCCTGCCCCGGCCAGAAGTCTGCTCACCAGCGATCACAAAGGTTCTAAGGGTTCCCCTCTCAGCGAGTGCTCTGGC AACTTCCATCGTTGAGGAAACCGCGTGAAAATAGATGGCTTTAACCTCAAGTTCCCAGGGACATGGGATTTTCGCTTCCT TCTCCAGGCAGTACCCCTTCCCAGTCGCTCTTATCGAGTATCCAAGGGAGTTTAGCTCCTTGATATGTTTCCAGACTGCC ACACGAGAAATTCCCAGCTTTCTTGCGAGCTCCGTTCCGCTGGCCGGGCCTTTTCTAAGCCTCCTGAGAATAAACCTTTT TGTCTCGCTTTCCCTTAAAGCGCCGCGTAGATGAACTTTCATGTGCGTTCGTTAACCAAATTATTTTTAACGTTTACTCG CTTCCCGGTGTGGTGGTTGA atgagaccaagagacatcggcttaatttccactttcacagcgtttacagccttaggtgc ccaggttgcgataccaattggccctgttccgataaccctgcaggtgctcttcgttcttctctcaggcctcgttcttgggg cacggctcggttttctgagtcagacgctctacctcctactcgggctgcttggctttccagtcttcgcccacctaggttct ggttttgccgttctctacggcccgactggaggttacctcctagcgtttcccctcgcttccttcctagccggcatgatgtc aggaaggggaaaagccatcgaaatggccggggctctgcttgcgataggtgcaatctatctcctcggttgggcaaggctct cgcttctaatcggccctgagaaggccttctacctcggcgtcctgcccttcgtaggtgttgacgttgctaaagcggttgta gcggttcttgtggcgaatgccgttagggaggccctaccggagggcaggttt TAAAACCTCCATCTCCAACTCTTTCTCA GGTGGGGGACATGACGCTCAGGGCGCACCACGTCAGGCTTACAACATTCATTCAGGCCACAGAGGATGAGGACAAAGTTC TTGAGGCGATAGGAACCTTCATTCCCGAGGATATAGACGATGAGGACGTTTACTTCGAGGTTCTCGAAACTGAAGGCTTC TTCGGTAACCCGATTAAGGTCGTGAACGTTGAGATAAAGAGGAGTAAAGCCGTGAGAGCGTTCCTCAGGCACTTCAAGGA GCTCCTCGACGAGAGCGCAAGGCGCTACATTCTGGAAAACCTCGACGAGAAGGTGGATGAGGAAGGAACACTCTACGTCC GCTTCAATAAGCAGAAGGCCTACCTCGGTGAGGTAGAGGTTGACGAGGGAGGCGACACGATTCAGGTCAAGATCAAAGTC AAAGCCTTCCCGATGAGGAAAGAGGCCGTCGTGAAGGCCGTGAGGGAGTGGCTGGAGGAGAAGGAATGAGC