tg1805

Coordinates:1739202-1739666

>tg1805 hypothetical protein TGAM_1805
MGDMTLRAHHVRLTTFIQATEDEDKVLEAIGTFIPEDIDDEDVYFEVLETEGFFGNPIKVVNVEIKRSKAVRAFLRHFKE
LLDESARRYILENLDEKVDEEGTLYVRFNKQKAYLGEVEVDEGGDTIQVKIKVKAFPMRKEAVVKAVREWLEEKE

>tg1805 hypothetical protein TGAM_1805
gtgggggacatgacgctcagggcgcaccacgtcaggcttacaacattcattcaggccacagaggatgaggacaaagttct
tgaggcgataggaaccttcattcccgaggatatagacgatgaggacgtttacttcgaggttctcgaaactgaaggcttct
tcggtaacccgattaaggtcgtgaacgttgagataaagaggagtaaagccgtgagagcgttcctcaggcacttcaaggag
ctcctcgacgagagcgcaaggcgctacattctggaaaacctcgacgagaaggtggatgaggaaggaacactctacgtccg
cttcaataagcagaaggcctacctcggtgaggtagaggttgacgagggaggcgacacgattcaggtcaagatcaaagtca
aagccttcccgatgaggaaagaggccgtcgtgaaggccgtgagggagtggctggaggagaaggaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1738702 - 1740166 (Additional range around tg1805 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGTTTACAGCCTTAGGTGCCCAGGTTGCGATACCAATTGGCCCTGTTCCGATAACCCTGCAGGTGCTCTTCGTTCTTCT CTCAGGCCTCGTTCTTGGGGCACGGCTCGGTTTTCTGAGTCAGACGCTCTACCTCCTACTCGGGCTGCTTGGCTTTCCAG TCTTCGCCCACCTAGGTTCTGGTTTTGCCGTTCTCTACGGCCCGACTGGAGGTTACCTCCTAGCGTTTCCCCTCGCTTCC TTCCTAGCCGGCATGATGTCAGGAAGGGGAAAAGCCATCGAAATGGCCGGGGCTCTGCTTGCGATAGGTGCAATCTATCT CCTCGGTTGGGCAAGGCTCTCGCTTCTAATCGGCCCTGAGAAGGCCTTCTACCTCGGCGTCCTGCCCTTCGTAGGTGTTG ACGTTGCTAAAGCGGTTGTAGCGGTTCTTGTGGCGAATGCCGTTAGGGAGGCCCTACCGGAGGGCAGGTTTTAAAACCTC CATCTCCAACTCTTTCTCAG gtgggggacatgacgctcagggcgcaccacgtcaggcttacaacattcattcaggccac agaggatgaggacaaagttcttgaggcgataggaaccttcattcccgaggatatagacgatgaggacgtttacttcgagg ttctcgaaactgaaggcttcttcggtaacccgattaaggtcgtgaacgttgagataaagaggagtaaagccgtgagagcg ttcctcaggcacttcaaggagctcctcgacgagagcgcaaggcgctacattctggaaaacctcgacgagaaggtggatga ggaaggaacactctacgtccgcttcaataagcagaaggcctacctcggtgaggtagaggttgacgagggaggcgacacga ttcaggtcaagatcaaagtcaaagccttcccgatgaggaaagaggccgtcgtgaaggccgtgagggagtggctggaggag aaggaa TGAGCGAGAGGGAATACTTCGTCGAGATGGACGTCAGGAGCGTGGAGGCCTACGAGCTAGCTAAGGAGTGGTT CGACGAGGTAGTCTTCACCAAAAAGCTCATCCTCGATACCGAGCCAGACTGGGACTCGCTGAAGGAGGAGCTTCGGGAGC TGAGGAGGACCTACGGGAAGGTCGCGGTTCTGCTCGTAACGAGAAAGCCGAGCCTGATACGGACCTTTAAAGCGAGAAAC CTAAAGGCCCTGCTCTACGTTCAGGGAGGCGACATGAGGGTCAACAGGATGGCCATCGAGGCAAAGGTTGACGCGCTGAT AAGTCCCTGGCTCGGGAGGAAGGATTACGGCTTCGACCACACCCTTGCTGGAATGGCGGGCAGGAGGGGCGTTGCAATCG GCTTCTCGCTCTCACCGCTCTTAAGGGCGAACCCCTACGAGAGGGCCTTAACGCTCCGCTTCATGGCCAAGGTCTGGGAG CTAGTAAGGAAGTATCGCGTCCCTCG