tg1806

Coordinates:1739666-1740307

>tg1806 Ribonuclease P protein component 3 (rnp3)
MSEREYFVEMDVRSVEAYELAKEWFDEVVFTKKLILDTEPDWDSLKEELRELRRTYGKVAVLLVTRKPSLIRTFKARNLK
ALLYVQGGDMRVNRMAIEAKVDALISPWLGRKDYGFDHTLAGMAGRRGVAIGFSLSPLLRANPYERALTLRFMAKVWELV
RKYRVPRFITSSAESKWEVRGPRDLMSLGINIGMEIPEARASLNFHPRSLLSRL

>tg1806 Ribonuclease P protein component 3 (rnp3)
atgagcgagagggaatacttcgtcgagatggacgtcaggagcgtggaggcctacgagctagctaaggagtggttcgacga
ggtagtcttcaccaaaaagctcatcctcgataccgagccagactgggactcgctgaaggaggagcttcgggagctgagga
ggacctacgggaaggtcgcggttctgctcgtaacgagaaagccgagcctgatacggacctttaaagcgagaaacctaaag
gccctgctctacgttcagggaggcgacatgagggtcaacaggatggccatcgaggcaaaggttgacgcgctgataagtcc
ctggctcgggaggaaggattacggcttcgaccacacccttgctggaatggcgggcaggaggggcgttgcaatcggcttct
cgctctcaccgctcttaagggcgaacccctacgagagggccttaacgctccgcttcatggccaaggtctgggagctagta
aggaagtatcgcgtccctcgcttcatcacaagctccgccgaaagtaaatgggaggttcgcgggccgagggacttgatgag
cctcgggataaacatcgggatggagattccagaggcgagggcaagcctgaacttccacccgcgctcacttctctcgcgcc
tt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1739166 - 1740807 (Additional range around tg1806 is :500nt.)

>Thermococcus gammatolerans EJ3 CAGGTTTTAAAACCTCCATCTCCAACTCTTTCTCAGGTGGGGGACATGACGCTCAGGGCGCACCACGTCAGGCTTACAAC ATTCATTCAGGCCACAGAGGATGAGGACAAAGTTCTTGAGGCGATAGGAACCTTCATTCCCGAGGATATAGACGATGAGG ACGTTTACTTCGAGGTTCTCGAAACTGAAGGCTTCTTCGGTAACCCGATTAAGGTCGTGAACGTTGAGATAAAGAGGAGT AAAGCCGTGAGAGCGTTCCTCAGGCACTTCAAGGAGCTCCTCGACGAGAGCGCAAGGCGCTACATTCTGGAAAACCTCGA CGAGAAGGTGGATGAGGAAGGAACACTCTACGTCCGCTTCAATAAGCAGAAGGCCTACCTCGGTGAGGTAGAGGTTGACG AGGGAGGCGACACGATTCAGGTCAAGATCAAAGTCAAAGCCTTCCCGATGAGGAAAGAGGCCGTCGTGAAGGCCGTGAGG GAGTGGCTGGAGGAGAAGGA atgagcgagagggaatacttcgtcgagatggacgtcaggagcgtggaggcctacgagct agctaaggagtggttcgacgaggtagtcttcaccaaaaagctcatcctcgataccgagccagactgggactcgctgaagg aggagcttcgggagctgaggaggacctacgggaaggtcgcggttctgctcgtaacgagaaagccgagcctgatacggacc tttaaagcgagaaacctaaaggccctgctctacgttcagggaggcgacatgagggtcaacaggatggccatcgaggcaaa ggttgacgcgctgataagtccctggctcgggaggaaggattacggcttcgaccacacccttgctggaatggcgggcagga ggggcgttgcaatcggcttctcgctctcaccgctcttaagggcgaacccctacgagagggccttaacgctccgcttcatg gccaaggtctgggagctagtaaggaagtatcgcgtccctcgcttcatcacaagctccgccgaaagtaaatgggaggttcg cgggccgagggacttgatgagcctcgggataaacatcgggatggagattccagaggcgagggcaagcctgaacttccacc cgcgctcacttctctcgcgcctt TGATGCTTTTTGACCAATCTTAGCATTCTGTCAGTTGTCCACATAAGTTGTTGTAT TCCCCACAGATTTCCAAATTTACAGGTATTTTTAGCGAAATTTTGTCACTTAGATGAGCTTTCTTTCGAAAGGCTTATAT TCATCAAAAGGTGCGCTAAAGCGGGTGGTCACCCATCGGTGGTCGAGAAACTCTCAGTTGTCAAGTTCGGTGGAAGCTCG GTAAGGGACTCGTTCTGGAGTGCACTAGAGCTGGTTGACTACCTACTCGAGGGAAGCAGGTTAGTGGTTGTCGTTTCTGC CCTCAGGGGCGTCACGGAGAAGCTTTTAGAGCTCTCGGAGCGGCCAGAGTGGGAACTCTTTGAGAGCATTGCCTTGGAGC ACTCGAGAATAGCCGATAAGCTCGGTGCAGAGGTAAAGCCCCTGCTCGACGAACTCGAAAAAGCCATCAAGGAGAACCGC CACGATCCCGAGTGGAAGGACTACATCCTCTCCTTCGGGGAGA