tg1821

Coordinates:1752942-1753379

>tg1821 Archaeal regulatory protein tfx, LuxR family (tfx)
MPSKSFLTDQQIKILRLRAMGLRQSEIAELLGTSRANVSILERRALEKIEKARNTLLLWEQINSKVSVEVRRGDDIFEIP
ERLFRKADEIGVKVPYSTAEIIAFLVEHAPVEDRLAKRDFTLFLDSSDRLRVSECILEDFDEIRKD

>tg1821 Archaeal regulatory protein tfx, LuxR family (tfx)
atgccatccaagagcttcctcactgatcagcagattaaaatacttcgattgagggcgatgggattgagacagagcgagat
cgccgagcttttaggcaccagcagggccaacgtgagtatacttgagaggcgggcactcgaaaaaatcgagaaagccagga
acacactcctcctctgggaacagatcaactcaaaggtaagcgttgaagtaaggaggggcgatgatatctttgaaatcccc
gagaggctcttcaggaaggctgacgagattggagtgaaggttccgtacagcaccgctgaaataatagcatttctcgttga
gcatgctcccgtcgaggataggctcgcgaagagggactttacactctttctagattcaagcgacaggctacgcgtcagtg
agtgcattctagaggacttcgatgagataaggaaggac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1752442 - 1753879 (Additional range around tg1821 is :500nt.)

>Thermococcus gammatolerans EJ3 ATCTCAAACGGGTCAATCTCGACCATCCATACCACCTCTGTTTCTCGGTAATTTGCGATAGGCTCTTAGGCATTTGCGTA TATAAACCTTTCGAAAAAAGGCCGGAAAACAGTCCGTTCAAAACAAAAAGTTTACTACGAAAATTTTTGATTTAATGGCC CCATTAGATCAAAGATCTGGTCGAATGGGGGAATGTACATCGAGGATTTTATATACATTGAAGAACACTAAAGGCCACTG AGGTATGAAAAATGAACTAACTTTGGTCCTCAGCGAGAAGTCGGTCATCATCCCGTCAGCTCACTCTCTTTCCAATCATC GGACCAGAATATGGAGCCCCGGGCGGGATTTGAACCCGCGACCGGCGGATTACAAGTCCGCCGCCCCGCCAGGCTAGGCT ACCGGGGCACCAATCTAAAGGAAAGGCCGAAAATTATAAACCTTTCGTTTCCCGAAAGTCTTTTAATGTTTGACGTTTTG TTAAACTTCGGTGTTTAAG atgccatccaagagcttcctcactgatcagcagattaaaatacttcgattgagggcgatg ggattgagacagagcgagatcgccgagcttttaggcaccagcagggccaacgtgagtatacttgagaggcgggcactcga aaaaatcgagaaagccaggaacacactcctcctctgggaacagatcaactcaaaggtaagcgttgaagtaaggaggggcg atgatatctttgaaatccccgagaggctcttcaggaaggctgacgagattggagtgaaggttccgtacagcaccgctgaa ataatagcatttctcgttgagcatgctcccgtcgaggataggctcgcgaagagggactttacactctttctagattcaag cgacaggctacgcgtcagtgagtgcattctagaggacttcgatgagataaggaaggac TAAAGCCGTGAAGACTCCATT CAGAGCCATGCCGAGACCGCTGACGGCACCGGCAAGCTCGTCCTCGATTATTATCCTCGCCGTCCCGAGGCCGTGGGAGC TAACGCCAGTTGCCAAACCCCTCGCTATTCTGTCCCTTACCCGAAAGAGGTTCAGCAGTTCTGGGGCGAAGGCATTGCCT AGTAGTCCGGTCGTTATAACGAGAACGGCCGTTAAAGCCGGTATTCCTCCGATTTTGGTGCTTATTCCTATCGCTATTGC CGTTGTGACGCTTTTCGGAGCTATGCTCCTCAGAACGGTTCCGCTCGCCCCGAGAAGCTTGGCTATCCAGTAGGCGGTGA GCATCGCGGTGGTTCCGCCAACGATGATTCCAGCGGCAATCTCCCTCGAGTACCTCGCTATTAAACCCGTATTCTTGTAA ACGGGAACAGCCAGGCTCACGACGGCGGGCCCGAGGAGGAACTTCAGGAAGACCGCGCTCTCCATATATGAACCGTAGG