tg1824

Coordinates:1755203-1755787

>tg1824 Thermonuclease (nuc)
MEQRSLGIYISVVLISFLILAGAYTFSHSTLDRSQPQTHVYLGNDSQKVLVYVTRVVDGDTAWVRFPNGTEEKVRFLGVD
TPETEEDRNRPNEYDHITDLRCLTIWGLKAEQFTKEIIEHKQVYLVFDPISPRRGYYGRLLAYIYLTNGTDFTAELVKEG
YARVYVEGTFEKKEAYLEYQKEAMKKGLGLWGACG

>tg1824 Thermonuclease (nuc)
atggagcaaaggtcacttgggatctatatctcggtcgttctaatctcgtttctcatacttgcgggggcttacacattttc
ccacagtacactggatcggagtcaaccgcagacccacgtatatttggggaacgattcccaaaaagttttggtctacgtca
cccgtgtcgtcgatggggataccgcctgggttcgctttccaaacggcacagaagaaaaagtgaggttccttggagtggat
acccctgagacggaagaggacagaaacaggcccaacgagtacgaccacataacggatcttagatgtctaacgatatgggg
tttaaaggccgagcagttcacgaaagagataatcgagcataagcaggtctatcttgttttcgatccgatctccccgagga
ggggctactacgggaggctcttggcatacatctatctcacgaacggcaccgatttcactgccgaactcgtgaaagagggc
tatgcgcgggtctacgttgaggggacctttgagaaaaaggaggcgtacctggagtatcaaaaggaggctatgaagaaggg
gttggggctctggggagcctgcggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1754703 - 1756287 (Additional range around tg1824 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTCGAGCTCGAGGTTGACGTCCTCGCTCCTGCAGCAATCGAGGAGGTCATCACCGAGAAGAACGCCGACAACATCAAGG CCAAGATTGTCGCCGAGGTTGCCAACGGTCCGGTCACCCCGGAGGCCGACGACATACTCCGCGAGAAGGGCATCCTCCAG ATTCCGGACTTCCTCTGTAACGCCGGTGGTGTCACCGTCAGCTACTTCGAGTGGGTCCAGAACATCAACGGCTACTACTG GACCGAGGAGGAGGTCAGAGAGAAGCTCGACAAGAAGATGACCAAGGCCTTCTGGGAGGTCTACAACACCGCCAAGGAGA AGAACATCCACATGCGCGACGGTGCCTACGTCGTCGCCGTCCAGAGGGTCTACCAGGCCATGCTCGACCGCGGATGGGTC AAGAAGTGATCTCTTCTCCCTTTTTAATTCCTTGAGCGAAGTGTCCATAGCAAAGTTTAAATTGGGAGTTTCTCTTCTCA AACGATCGGCTGGTGATCAC atggagcaaaggtcacttgggatctatatctcggtcgttctaatctcgtttctcatact tgcgggggcttacacattttcccacagtacactggatcggagtcaaccgcagacccacgtatatttggggaacgattccc aaaaagttttggtctacgtcacccgtgtcgtcgatggggataccgcctgggttcgctttccaaacggcacagaagaaaaa gtgaggttccttggagtggatacccctgagacggaagaggacagaaacaggcccaacgagtacgaccacataacggatct tagatgtctaacgatatggggtttaaaggccgagcagttcacgaaagagataatcgagcataagcaggtctatcttgttt tcgatccgatctccccgaggaggggctactacgggaggctcttggcatacatctatctcacgaacggcaccgatttcact gccgaactcgtgaaagagggctatgcgcgggtctacgttgaggggacctttgagaaaaaggaggcgtacctggagtatca aaaggaggctatgaagaaggggttggggctctggggagcctgcggt TAGACCTTCGCCCAGTAGTCCTTCTCATCCACC ATCGCCCTTATCATCTCGTCCTCGTCCCTGAACATCGTTCTTCTCGATGGGTTCTGCATGCCGTAGAACTCCATGAACGG GCTCGGACGCCTCTTGAAAGGGTAGTAAAGGTATATCGCCGCAAGCGTCCTGTAAGCTTCTGCCATCTCGCTTATAACGC CCGCCGAAACGCCCTCTGCGTAGTGATAGACAGCTATCGCCCTGCTGACATCGACGAGGTTGAAATCTCTCTCGACGAGC TGTCTCCTAAGTATTTCAGTCGCCTGCTCTATGTCTTCCCTCTCCAGTTCATCGACCTCGTTCCCGTCGAGGAGGTGCTT TATCCTGATCCTCCTCACGTCCGGGTTCTTGGCGACTTGGTTGTCGTATTCAGCGACGACCCACCAGTCGTCGAGAGCCC CGGGGTCGAGAACCGTGAAGTGCTCGCTCAGCTTGTCGTAGAATCCCCTGACGCGGTGGTAGTACT