tg1831

Coordinates:1762543-1763097

>tg1831 hypothetical protein TGAM_1831
MFMDERVPSQEILLKEWDVTSREMLANIDWQWETIRMYLTVMGFLLIAYNYLVYQFSIPYLQHDSGNAVLPKMIIVFVSL
LIPILSIPITYYTVHIFEYRYRRFLDKAYTMNRLRVRLGLSNEDLKLYPPRYYDGLKKDHCEFVEGIIKRRDPPTFYGQG
RKFIFVLEGIFLLEAIVVAILLWWI

>tg1831 hypothetical protein TGAM_1831
gtgtttatggatgaaagggtacctagccaggagatacttctaaaagaatgggacgtcacttctagggagatgctagctaa
catagactggcaatgggaaacgataagaatgtacttaacggttatggggttcttgttaatagcatacaactacttagttt
atcaattctcaattccatacctccagcatgactcaggaaatgccgttctgcccaagatgattatagtatttgtttctctt
ttaataccaattctaagcatccctataacttactacactgtccatatattcgaatatcgttacagaaggttcttagataa
agcgtatacgatgaacaggcttagagtaagattgggtctcagtaacgaggatttaaagttatatcctccccggtactacg
atggactgaaaaaagaccattgtgaattcgtagagggaataatcaagcgtagagatccaccaacattctatggacaaggt
cgcaagttcatttttgttctcgagggaatattcctcttagaagcaattgtagtagcaatattgctgtggtggata


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1762043 - 1763597 (Additional range around tg1831 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGGAGGAAGAGTTCGTCAAGGCCTTCATCGAGGACGTCAAGGAGATAATCCGCGTTGCTAAGATAGAGAAGGCGGAGAG GGTCTACGTTTATACAGCCCCTGAGTGGAAGTGGAAGGTCGTTGAGGTCGTTGCCGAGAAGAGGGATTTCAAGTCGGCGA TGGCAGAGCTGATGAAGGACCCGGAGATGAGGGAGCACGGCAAGGAGATAAGCAAGCTGATACAGCGCCTTATAAAGGAG AGGGCCTTCGAGGTCAAGCGCATAGACGAAGAGAAGGCGCTGAGGGAAGCCAAGGACTTCATAGAGAAGGAGCTCGGCGT CGAGCTGATAATCAACCCCGAAGAAGATAAGGGAGGAAAGAAGAGGCAGGCGATGCCGCTGAAGCCTGCTGTGTTTGTGG AGTGAGAGCTAGTTAAATCTTCTCTTACCTTTTTCACAACTCTTTCTTGTAACTCCATAACATGCCAACGAAAAGGTTAT AAAAATTTTCACTCAATGT gtgtttatggatgaaagggtacctagccaggagatacttctaaaagaatgggacgtcact tctagggagatgctagctaacatagactggcaatgggaaacgataagaatgtacttaacggttatggggttcttgttaat agcatacaactacttagtttatcaattctcaattccatacctccagcatgactcaggaaatgccgttctgcccaagatga ttatagtatttgtttctcttttaataccaattctaagcatccctataacttactacactgtccatatattcgaatatcgt tacagaaggttcttagataaagcgtatacgatgaacaggcttagagtaagattgggtctcagtaacgaggatttaaagtt atatcctccccggtactacgatggactgaaaaaagaccattgtgaattcgtagagggaataatcaagcgtagagatccac caacattctatggacaaggtcgcaagttcatttttgttctcgagggaatattcctcttagaagcaattgtagtagcaata ttgctgtggtggata TAAATACCGCAAAATACAAAGTTTTCAAATCTACCATTAATTTTTCCCCAACTTATAAGACCTT TTCTCCGAAAACACCTTAAATAGAAGGCCTTTTTTGGTGTTTTCCATGCCCGTTAGCGAGGAAACTTTCAAAAAAGACGT CCTTTCAAAAATCCCGCGCCGGAACGAACCACCCTTACCTTCTGATGGGCTCCACGTTGAAATGCTCGAACGCTTCCGCG TCCGACCTTCATTACCCGACGATTGAGAAGCTCAAGGCGCTCGTTGAGCGGGCCGGTGGTAGAATAATCAGGAGCGGGAC CTTCGAGCCTAAGTTGCCACACTACCTCGCATATATTCCTCGCGAGTACGTGGCACGGATAGAGGACGAGGAAAAGCGCG CCGAGCTTTTGAGGAAGTGGGATGAAGTCTACGAAAAGTGGAAGATAGGGGCAGAGCATCCCCCAGTGGGATGGCTGAGT GCAAAGCGCTGAGCTTGCTGAGCTCAAGGTTCGTTT