tg1836

Coordinates:1769733-1770074

>tg1836 hypothetical protein TGAM_1836
MKLLPRPKTAVMMSFSLMALYFVGIGVLSMEYPLQLVGAVFVGGIHALLGWGIYSGKEWSIGLGKYLSFVDLIFSILWMM
LGVLPQGAALFFLSALVLVLLSDSEVEGEILGRV

>tg1836 hypothetical protein TGAM_1836
atgaagctcctcccccggccaaaaacggccgtcatgatgtctttttctcttatggccctctacttcgttggaataggggt
tctctcaatggagtatcccctgcagttggtcggggctgttttcgttggtgggatccacgccctcctcgggtgggggattt
acagcgggaaggaatggagcatagggttgggaaagtatttatcctttgtcgatctcattttctcgatactctggatgatg
ctcggtgttctgccccaaggtgctgctcttttcttcctctctgctctcgttcttgttctcctgagtgattcggaggttga
aggggagattctcggcagggtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1769233 - 1770574 (Additional range around tg1836 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAGCCTTTTATGTGTGGGCAAAGATAGATCCCGAGCTTGATATGAGCAGCGAGGACTTTGCCGAGTGGCTCCTTGAGAA CGCGGGCGTCGTGGTAATCCCGGGAACAGCATTTGGAAAACACGGCGAGGGATGGATCAGGATAAGCTACGCAACGAAAA AAGAACAGCTGATCGAGGCTATGGAGAGAATGAGAAGGGCCCTTGAAAAGCTGTGAGGTGAGCCCTTTGGATCCTCTAAT TTACATTTCCGTGATGGTATTTCTGGCGGAGCTCGGAGATAAAACCCAGCTGGCAACTATGGCCTTTGCAACCAAGTACG GGTGGAGGAAGGCATTTGCCGGGGCGATAATAGGGCTGGCACTGATCAATTTCCTCGGAGCCGTTGTGGGTGAGAAGCTG GGTGAACTCCTGCCTCAGGAGGTAATACACAAGGGGGCGGGGGCATTTTTCATCTTAGTAGGCATTCTAATGATGGCTGG GAAACTGTGAGGTGATACC atgaagctcctcccccggccaaaaacggccgtcatgatgtctttttctcttatggccctc tacttcgttggaataggggttctctcaatggagtatcccctgcagttggtcggggctgttttcgttggtgggatccacgc cctcctcgggtgggggatttacagcgggaaggaatggagcatagggttgggaaagtatttatcctttgtcgatctcattt tctcgatactctggatgatgctcggtgttctgccccaaggtgctgctcttttcttcctctctgctctcgttcttgttctc ctgagtgattcggaggttgaaggggagattctcggcagggtt TAATCTCGGGGTTTAATCTCAATAGTGAAAATAGTGA AACAAGCCAATTAAGAGCAACCAAAACCAAGGATAGCTGTTTTAAAGGCTATGCCATTTTGATCAAATTTCTCATCGAGA AAAGTTTGTACTGGTGGGCCCGGGGGGCTTTGAACCCCCGACCACGCGGTTATGAGCCGCGCGCTCTGACCAGGCTGAGC TACGGGCCCACTGATGGCGCCGCCGCCCGGATTCGAACCGGGGACCGCCGGATTAACAGTCCGGCGCTCTACCAACTAAG CTACGGCGGCTCGACCCAATGTAGGGAACATTGGGTGAATTTATAAATCTTGCGGTCTCTTCACAGCTGTGAAAAACATG TTCGGGAAGGAAACTTTCCTCAACAAAAAGGGCACCCCGAGACTCAGGGCGATGTTCCTCATCATTCTTGCTTACGCCTA CTGGAATCTCTACAGTTTGATCTATCCGGCGCTTGGCCGCTGGAGCGTCAACTACACTGATCT