tg1850

Coordinates:1780107-1781042

>tg1850 ABC-type sugar transporter, permease component
MDRRKLRELSFFLSPMLLMVFLFYLIPLVMTVYISMTRMRNWNVERYLTDFVGLYNYHRLFYMFQHDPTFKAVIMTTVVF
VGITLLINVFGGLLLSLAIFFIEERPASFYRLLWLLPRMSPIAVYSLVWYYFFHGSEIGTLNSFLMHLGLISQPIPWGQI
IPWGAWSVIIFVNGLVGVSFGMIVFTSALNQIPRELIIAARVDGASSWQISRKILIPMMRWHLLYVFTWQFLSLLTTYPH
LFLLVEWDLVNRDYGTTLALYVFNTAFGMGEQDQGLAAAAAVILSIIGILGGLVTLKVLKFERMMKKPRGDF

>tg1850 ABC-type sugar transporter, permease component
atggacaggcgcaagctcagggagctttccttctttctttctccaatgcttctgatggtgttcctgttctatctgattcc
cctagttatgaccgtttacataagcatgacgcgcatgaggaactggaacgttgagaggtatctcactgactttgtgggcc
tttacaattaccacaggctcttctatatgttccagcacgatccgacctttaaggctgtaatcatgacaacggtcgtgttc
gttggaatcacgctcttgataaacgttttcgggggtttactcctttctctcgccatatttttcatagaggaaagaccggc
ctccttctatagacttctctggctcctccccaggatgtcgccgatagcagtgtacagcctcgtctggtactacttcttcc
acggcagcgagattggaacgttgaactcattcctcatgcacctcgggttaatctctcagcccattccctggggccagatt
atcccttggggggcttggagtgtaataatattcgtgaacggtttggtgggtgtgagttttggaatgatcgtcttcacctc
ggccttgaatcagatacccagggaacttattatagccgcgagggtcgatggtgcttcctcttggcagatatcgaggaaaa
tcctaatccccatgatgagatggcacctcctctatgttttcacgtggcagttccttagcctgctgacgacgtacccccac
cttttcctgctcgttgagtgggaccttgtcaacagggactacggaacaaccttagcgctctacgtcttcaacaccgcctt
tggcatgggcgagcaggatcaggggcttgcggccgccgccgcggtaatactatcgataatcgggatcctcggcggtctcg
tgacgctaaaggttctcaagttcgagaggatgatgaagaaaccaaggggtgatttc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1779607 - 1781542 (Additional range around tg1850 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAAGTACGACGAGCTCAAAGACGTTTACCACAAGCTCGCCTTCCTGATGCTCATCAAGGCCAGCGACCCTGATATAAAC GCCATACACAGCGTCATCTCCGCCCACCTGCCAGTGAGAAAGGATGCTGCTAAGCTGATCAAGGACGAGAAGTGGCTCAA CGATCTGAAGAACCTTAACCTTGACCTCGATCAAAAGGTTAAGGACAACATCCGGGACATCGTGAAGGCAACGGTCAATC CGATAAACGCCCAGTTCCTGGCGGACGTCAGTTACATGCTCGAATACACCCACTTCGCTCCGGCCCATCCGAAGTACCCA GCACTGGCAGATATCTTCAAGGAAGCGGTGGACAAGGCCATTCGTGGCGAGATGACTCCGGAGGAGGCTGTCAATTACAT AATCCAGAAGGTCAAGGCCGATCCCGAGCTCGCCCAGAACGTCGAGATCAAGGGTGAAATACCCAAGGACTGGAAGTTCC CGCAGGAATGAGGTGGTGAC atggacaggcgcaagctcagggagctttccttctttctttctccaatgcttctgatggt gttcctgttctatctgattcccctagttatgaccgtttacataagcatgacgcgcatgaggaactggaacgttgagaggt atctcactgactttgtgggcctttacaattaccacaggctcttctatatgttccagcacgatccgacctttaaggctgta atcatgacaacggtcgtgttcgttggaatcacgctcttgataaacgttttcgggggtttactcctttctctcgccatatt tttcatagaggaaagaccggcctccttctatagacttctctggctcctccccaggatgtcgccgatagcagtgtacagcc tcgtctggtactacttcttccacggcagcgagattggaacgttgaactcattcctcatgcacctcgggttaatctctcag cccattccctggggccagattatcccttggggggcttggagtgtaataatattcgtgaacggtttggtgggtgtgagttt tggaatgatcgtcttcacctcggccttgaatcagatacccagggaacttattatagccgcgagggtcgatggtgcttcct cttggcagatatcgaggaaaatcctaatccccatgatgagatggcacctcctctatgttttcacgtggcagttccttagc ctgctgacgacgtacccccaccttttcctgctcgttgagtgggaccttgtcaacagggactacggaacaaccttagcgct ctacgtcttcaacaccgcctttggcatgggcgagcaggatcaggggcttgcggccgccgccgcggtaatactatcgataa tcgggatcctcggcggtctcgtgacgctaaaggttctcaagttcgagaggatgatgaagaaaccaaggggtgatttc TG ATGAAAGACGTTGAGACGAGACCCAGAAGGTACGGGCTGGTTATAGTGCTCGCCCTCCTGCTCGCGAGCCTGCCACTTCT CGGCGCCTTCTCCCTGCTCGTCCTTTCGAGCTTTAGTAATCAAATGGTCACAGACCTAAGTCCTGGTTCATTTCATCCAA CGCTGGAGAACTGGATAAACCTCTTTCACGGTAAAATCGCAACGACCGGTGGAATAAGGGTCAACATATGGCGCATAGCC CTCAACACCCTCATCGTCGCTATGGGTGTTTCCCTCGTCGTGACGGGGATTAGCGCCCTCGCCGGTTACTCCCTCTCAAG GATGGACTTCAGGGGGAGGAAGACCATGATGGTTCTCCTCCTCCTTTTGCACGCCTTCCCGGGCGTGGCCCTGATCGTGG GCGTTTACCTGCTCTATCGCCTGACTTTCCCAGCTAGCACGACCGCAGTGGGGCTGTACTCATTCGTTTACGTTATACTG GCCCGGGCTGCCCTTGA