tg1854

Coordinates:1784383-1785114

>tg1854 ATP-binding protein, PP-loop superfamily
MVEMRVAVLYSGGKDSNYALYWALEQGFEVKYLVSMVSEREDSYMYHVPNIHLTELQARAIGIPLVKGFTSGEKEKEVED
MKAVLEGLKIDGVVAGALASEYQKKRVDKVARELGIESFAPAWHRDPIEYMRELIGIFDIVMIGVSAYGLDESWLGRRID
EKALEELVKLHEKYGIHVAGEGGEFETFVRDAPFFKARIVFDEVEKKWDGFNYSGVLEVKRAHLERKSKNKNRNGPIGGA
QMKS

>tg1854 ATP-binding protein, PP-loop superfamily
gtggtggaaatgcgagtggcggtgctgtattccggcggaaaggactcgaattacgccctctactgggcactggagcaggg
ttttgaggttaaatacctcgtctcgatggtgagcgagagggaagacagctacatgtaccacgtgccgaacattcacctca
cggaactgcaggcgagggcaatagggattcccctcgtcaagggcttcaccagcggcgagaaggagaaagaggtagaggac
atgaaggccgtccttgagggcctgaagattgacggcgtcgttgcaggagccttagccagcgagtaccagaagaagcgcgt
tgataaagtggcgagggagctcggcatagagagcttcgcgcccgcttggcaccgcgacccaatcgaatatatgcgcgagc
tgattgggattttcgacatcgtaatgatcggcgtctcagcctacgggctggatgagagctggcttggcagaaggattgac
gaaaaggctctggaggagcttgtgaagctccacgagaaatacggaatccacgtagctggagaggggggtgagttcgagac
cttcgtcagggatgcgcccttcttcaaagccaggatagtcttcgacgaggtggaaaagaaatgggacgggtttaattatt
ccggagtgcttgaggtcaaaagggcccaccttgagagaaagagtaaaaacaaaaacagaaatggccccatcggtggggca
caaatgaaatca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1783883 - 1785614 (Additional range around tg1854 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTAACCTTCGTCGCCTCTTCAACGTCAATCCATCTCGGCTCTCTGTCCGCTATGAGGCCGTTTCCCCTTATTGCCTCCG CAACGAAGGACTCGTTGTAGACGTGGTCGCTCATGACGAGGACGAACCGCCCGGAGACATGACTTTTAGCGAGGTGGAGC GAGTGGCCGTTGCCCTTCTCGGGCTCGGGGTTTATCACGAGCTCGGCGTTAAAGCCGTGCCTTTCAACGAACTCGCGGTA GAGGGGAGCGTACCGCTCGTTGGTGACGATTACAAACCTCTTAACGCCATTCCTCTGGAGGAGGTGCATCGTTCGGTACA GAATCTCCCTCCCTGCAACTTTGAGGAGTCCCTTGGGCCTTCCGCCCATCCTCGTCCCAAGGCCGGCCGCGAGAATCACT GCCGTTTTTGGGGTCATCGGCATCACCTTTTTAAGGCCCTCGAAGAGGCCCCACCAGGAGAACCGAGATTAAATTAACCA TAGGTAATTTAAAGCTTTCG gtggtggaaatgcgagtggcggtgctgtattccggcggaaaggactcgaattacgccct ctactgggcactggagcagggttttgaggttaaatacctcgtctcgatggtgagcgagagggaagacagctacatgtacc acgtgccgaacattcacctcacggaactgcaggcgagggcaatagggattcccctcgtcaagggcttcaccagcggcgag aaggagaaagaggtagaggacatgaaggccgtccttgagggcctgaagattgacggcgtcgttgcaggagccttagccag cgagtaccagaagaagcgcgttgataaagtggcgagggagctcggcatagagagcttcgcgcccgcttggcaccgcgacc caatcgaatatatgcgcgagctgattgggattttcgacatcgtaatgatcggcgtctcagcctacgggctggatgagagc tggcttggcagaaggattgacgaaaaggctctggaggagcttgtgaagctccacgagaaatacggaatccacgtagctgg agaggggggtgagttcgagaccttcgtcagggatgcgcccttcttcaaagccaggatagtcttcgacgaggtggaaaaga aatgggacgggtttaattattccggagtgcttgaggtcaaaagggcccaccttgagagaaagagtaaaaacaaaaacaga aatggccccatcggtggggcacaaatgaaatca TAAAAACCATCTCCTGAGCCAGGAGCGCCTTCCGAGGTCCTTTTTG ACGAGGAATACCGTCTTTTCGCATTCCTTCGCCACCTCAACGGGCAGTTCTCCAAACAGGCTTCTGGCGAAGAGCGAGCT CTCCGAGGCGCCCATTATAACGAGGTCGTGGTCGCGACACTCGGAAAGTATTGTCCTCTTGGGGTCGTCGGACCGGACAA CCTTCAAAGTGCCCCTAGCCCCGTTCAGAATCCTCATAACCGGCTCAAGGCGGCGCTCTATCCTCTTTCTCTCAATACCC TCCCTGTCAACGTAGAGTACTGTAACGCTCGCACCCTTTTCAAGGGCAAATATTCTCGCTATTTCCGCCGCTAGAAGGCT GTGAGGACCGCCAGCCGTTGGAAAGAGTATTCTCTTGACTTCTTCACCCCTTCCTGGCTTCACGAGCAAAACGTCACACG GGGCCTCCACGAGTCTGTCGAGGTTGCTGCCAAAGATGTACCCCAGCCTCGAA