tg1861

Coordinates:1792924-1793433

>tg1861 ADP-ribose pyrophosphatase (MutT)
MDRYVLLVKAPRGKDISEFREEVKSLAEKHGLKAELHRCIGLTVDGVIIYNNGLVLIKRKNEPFKDHFALPGGFVEYGET
VEEALKREMKEETGLDVRILKLVGVYSDPNRDPRGHTVSVAFLCIGEGELKAGDDAKEVHVVPIEEAEKLPLAFDHAKIL
RDALHPKDCW

>tg1861 ADP-ribose pyrophosphatase (MutT)
atggaccgttacgttctgctcgtcaaggccccgaggggtaaagacataagcgagttccgcgaggaagtcaagtccctcgc
agaaaaacacggtctcaaggccgagctccacaggtgcataggcctaaccgtagacggagtgataatctacaacaacggcc
ttgtcctcataaagcgaaagaacgaaccctttaaggaccattttgccctgcctggtggctttgtcgagtacggcgagacc
gtcgaggaggcgttgaagagggagatgaaggaggagacgggcttggacgttagaatccttaagctcgttggcgtttactc
cgacccaaaccgcgacccaagaggacacaccgtttccgtcgcctttctctgcatcggcgagggagagctgaaggcaggcg
acgatgcgaaggaagtccatgtcgtcccgattgaagaggcagagaagcttccgctggcctttgaccacgcaaagattttg
agggacgcgctccacccaaaggattgctgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1792424 - 1793933 (Additional range around tg1861 is :500nt.)

>Thermococcus gammatolerans EJ3 GATTCCGATGAGGAGCATCCCAATGCTGCAGGCCACGAAAAAGCCCCAGCTCACGTAGTAGTGCGGGCCCGTGCCCTCGG GAAACAGGCCTATCCCTGCAAGGAATATGAGACCGATCGCAAATACTACTACCCCCATCCGCTGGAGGGCACCTTTAAGT TCTTTCCACAGGCCGCTTATGTAATAAAGGCCGAGGGAAGCTGAGATTATTAGGCCCAGGTTCATCACCCAGTTATAGCT CAGACCAATCTTTCCGAGATCGCTGATTGCATTTTCAGTGACCCTCCACCACGACCTGTGGATCAAAATCGCGGCGAAAA CTCCACCAGGCCCAACAATGGGGGAAAGAATGCCCGCTATTAGTTGGCTTCTCTCCATGTTCCCACCGTGAATTCTAGGC ATCAACGATATAAACGCTTTGTGCAAACTGTGAACGACCGATGATGAAACGTCAGCACGCTGAACGCTGATGAGAAGGGA CTTCCCTGAGGTGAAAAAG atggaccgttacgttctgctcgtcaaggccccgaggggtaaagacataagcgagttccgc gaggaagtcaagtccctcgcagaaaaacacggtctcaaggccgagctccacaggtgcataggcctaaccgtagacggagt gataatctacaacaacggccttgtcctcataaagcgaaagaacgaaccctttaaggaccattttgccctgcctggtggct ttgtcgagtacggcgagaccgtcgaggaggcgttgaagagggagatgaaggaggagacgggcttggacgttagaatcctt aagctcgttggcgtttactccgacccaaaccgcgacccaagaggacacaccgtttccgtcgcctttctctgcatcggcga gggagagctgaaggcaggcgacgatgcgaaggaagtccatgtcgtcccgattgaagaggcagagaagcttccgctggcct ttgaccacgcaaagattttgagggacgcgctccacccaaaggattgctgg TGAGCGCTATGAAACTCGAATACCCCTCC TTTGGGAAGATCATCGTCGATGGCAAAACATACGAGCACGATGTAGTCGTTTATCCGAGCGGAAGGGTCGAGAAGAGGAA GAAGTGGCTGAGCAAGTCCAAGCACGGAACGAGCCACAAACTCGACCCCGACGAGCTGAGGGAGTACTTGACGGAGGACT TTGAGGTTCTAATCGTCGGCACCGGCTACTACGGCTATCTCTCGCTTCTCCCCGAGACCAGGGAGCTGGTCAGGGACAAA GAAGTGTATGAGCTCCCTACGGGAGAGGCAGTGGAGTTCTTCAACGAACTAAGCGGAAAGAGAAAGGTTCTCGGAATCTT CCACGTCACCTGCTGAGGTGCCAGAGCAACAGTGCGTCAACGATGGCAACGAAGGGAATCGAGAGGAAGCACTCAACGTA CCACAGTCCAGCTGTAACTCCGATTATTATACCGTTCGCAAGCAGGACAAGGAGCATCTTTTCCCATCTCG