tg1862

Coordinates:1793555-1794118

>tg1862 hypothetical protein TGAM_1862
MERSQLIAGILSPIVGPGGVFAAILIHRSWWRVTENAISDLGKIGLSYNWVMNLGLIISASLGLYYISGLWKELKGALQR
MGVVVFAIGLIFLAGIGLFPEGTGPHYYVSWGFFVACSIGMLLIGIGLYFQGEKTLGLLAFAIFTVGWILALWAKSHFRG
VAVAEFVGVFGIVIWHYALLKRFLLPKA

>tg1862 hypothetical protein TGAM_1862
atggagagaagccaactaatagcgggcattctttcccccattgttgggcctggtggagttttcgccgcgattttgatcca
caggtcgtggtggagggtcactgaaaatgcaatcagcgatctcggaaagattggtctgagctataactgggtgatgaacc
tgggcctaataatctcagcttccctcggcctttattacataagcggcctgtggaaagaacttaaaggtgccctccagcgg
atgggggtagtagtatttgcgatcggtctcatattccttgcagggataggcctgtttcccgagggcacgggcccgcacta
ctacgtgagctggggctttttcgtggcctgcagcattgggatgctcctcatcggaatcggtctctacttccagggcgaga
aaacccttggtcttcttgcgtttgcaatattcacagtcgggtggattctcgcactctgggccaagtctcacttcaggggt
gtggcggtggccgagtttgtgggtgtttttggaatcgttatctggcactacgcgctactcaagaggttcctcctcccaaa
ggct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1793055 - 1794618 (Additional range around tg1862 is :500nt.)

>Thermococcus gammatolerans EJ3 CGCCGATGCAGAGAAAGGCGACGGAAACGGTGTGTCCTCTTGGGTCGCGGTTTGGGTCGGAGTAAACGCCAACGAGCTTA AGGATTCTAACGTCCAAGCCCGTCTCCTCCTTCATCTCCCTCTTCAACGCCTCCTCGACGGTCTCGCCGTACTCGACAAA GCCACCAGGCAGGGCAAAATGGTCCTTAAAGGGTTCGTTCTTTCGCTTTATGAGGACAAGGCCGTTGTTGTAGATTATCA CTCCGTCTACGGTTAGGCCTATGCACCTGTGGAGCTCGGCCTTGAGACCGTGTTTTTCTGCGAGGGACTTGACTTCCTCG CGGAACTCGCTTATGTCTTTACCCCTCGGGGCCTTGACGAGCAGAACGTAACGGTCCATCTTTTTCACCTCAGGGAAGTC CCTTCTCATCAGCGTTCAGCGTGCTGACGTTTCATCATCGGTCGTTCACAGTTTGCACAAAGCGTTTATATCGTTGATGC CTAGAATTCACGGTGGGAAC atggagagaagccaactaatagcgggcattctttcccccattgttgggcctggtggagt tttcgccgcgattttgatccacaggtcgtggtggagggtcactgaaaatgcaatcagcgatctcggaaagattggtctga gctataactgggtgatgaacctgggcctaataatctcagcttccctcggcctttattacataagcggcctgtggaaagaa cttaaaggtgccctccagcggatgggggtagtagtatttgcgatcggtctcatattccttgcagggataggcctgtttcc cgagggcacgggcccgcactactacgtgagctggggctttttcgtggcctgcagcattgggatgctcctcatcggaatcg gtctctacttccagggcgagaaaacccttggtcttcttgcgtttgcaatattcacagtcgggtggattctcgcactctgg gccaagtctcacttcaggggtgtggcggtggccgagtttgtgggtgtttttggaatcgttatctggcactacgcgctact caagaggttcctcctcccaaaggct TAGCCCGTTTTCCCTCTCCTTTCTCTCGAGTGGGCTACCCTTAAGCTCCTGGAT AAAAACTTCCGCGACGAAGACTTTTCCCTCGAAGAGATGCCCGCCGTAAAGCCTACCCTCCCCATCCCCAAGGGCAACGT GAATGTGCGCGAAGGGCTTTTCATTCCTGAGGCTCACGTTCCCCACCAGTGAAACCATCTCAAACGTTCCCTCCAGTTCA ATAATTCGGTAGTCGTTGATATCCTCGTCAAAATAACCTATTTTTGGATCTTTCAAGCTTCCAATTGCACTCACAACGCC GGTTTTTATCTCCTTGGCCTCTGCAAAGCGGTTCACGAATTCAAGGAGATCCTCCCCCTCTGGCACGCGAAACAGAAAGG TCCTTCCCCCGGAGAACTCCATGAGGCTCACCCAAACCCTAATAAGCCGTCCGACCCTTTAACCCTTTGGGTGTGGGAAG TGCAGGCGAAGAACGCTGTAATGGCAGTGCTTCCAGAACTTGTGG