tg1864

Coordinates:1794563-1795123

>tg1864 hypothetical protein TGAM_1864
MWEVQAKNAVMAVLPELVELEDVDFSRYSSQYLSLAVSFAESGGRGLREFEEFVAARGLGKAVVGNFLLSVFQYLMIRYR
RYGDRDVIKPAIKLFLTLKGWLNENGFENQWKLLLHNFVGYIVDMARVISEEEDCELALAYLTLINRLAEEAAGTFPEGY
FKDLTEKSSEMLKKIRDRCSGRVSVQG

>tg1864 hypothetical protein TGAM_1864
gtgtgggaagtgcaggcgaagaacgctgtaatggcagtgcttccagaacttgtggagcttgaggacgtcgatttctccag
gtattcgagccagtacctaagcctggcagtttcgttcgctgaaagcggcgggagaggcctgagggagttcgaggagtttg
ttgcagcgagggggctggggaaagctgtcgttggaaactttctgctgtcggtctttcagtacctgatgatcagataccgg
cggtacggggacagagatgtaattaaacccgcgatcaagcttttcctcacccttaagggctggctcaacgaaaacggttt
tgaaaaccagtggaagctgctccttcacaacttcgtgggttacattgtggacatggccagagtgatctcagaagaggagg
actgtgagctcgccctcgcctaccttacgctaattaaccggctcgcagaggaggcggcggggacgtttccagaggggtac
ttcaaggatctgaccgaaaaaagtagtgagatgctgaagaaaatcagggatcgctgttccggaagggttagcgttcaagg
a


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1794063 - 1795623 (Additional range around tg1864 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGGAATCGTTATCTGGCACTACGCGCTACTCAAGAGGTTCCTCCTCCCAAAGGCTTAGCCCGTTTTCCCTCTCCTTTCT CTCGAGTGGGCTACCCTTAAGCTCCTGGATAAAAACTTCCGCGACGAAGACTTTTCCCTCGAAGAGATGCCCGCCGTAAA GCCTACCCTCCCCATCCCCAAGGGCAACGTGAATGTGCGCGAAGGGCTTTTCATTCCTGAGGCTCACGTTCCCCACCAGT GAAACCATCTCAAACGTTCCCTCCAGTTCAATAATTCGGTAGTCGTTGATATCCTCGTCAAAATAACCTATTTTTGGATC TTTCAAGCTTCCAATTGCACTCACAACGCCGGTTTTTATCTCCTTGGCCTCTGCAAAGCGGTTCACGAATTCAAGGAGAT CCTCCCCCTCTGGCACGCGAAACAGAAAGGTCCTTCCCCCGGAGAACTCCATGAGGCTCACCCAAACCCTAATAAGCCGT CCGACCCTTTAACCCTTTGG gtgtgggaagtgcaggcgaagaacgctgtaatggcagtgcttccagaacttgtggagct tgaggacgtcgatttctccaggtattcgagccagtacctaagcctggcagtttcgttcgctgaaagcggcgggagaggcc tgagggagttcgaggagtttgttgcagcgagggggctggggaaagctgtcgttggaaactttctgctgtcggtctttcag tacctgatgatcagataccggcggtacggggacagagatgtaattaaacccgcgatcaagcttttcctcacccttaaggg ctggctcaacgaaaacggttttgaaaaccagtggaagctgctccttcacaacttcgtgggttacattgtggacatggcca gagtgatctcagaagaggaggactgtgagctcgccctcgcctaccttacgctaattaaccggctcgcagaggaggcggcg gggacgtttccagaggggtacttcaaggatctgaccgaaaaaagtagtgagatgctgaagaaaatcagggatcgctgttc cggaagggttagcgttcaagga TGATCTCCGCATAACTCCTCGGATCCTCCCAGATCCGCACGAGGATCCGTTTTACGT TCTTTCCTGCTTTCTCAGCTATCCTCTCGGCGAACCACTCCGCTATGTACTCCGCGGTGACGTTAGGTTTGTTCAGGATC ACTACCTCTCCCTCTGGCAGTTCGAGTCTCTTGCCGTTCTTCTCAACGATGACAACTCCTCCGTCCATCCCGACAACCCA CGCCTCGCTCACCAGAATCCTGTGGTCAAGCTCCTTGACAAGATTGCTCAGGTGGTTGAAATCGAAGATCATACCGTTCT CGTTCAGCCCGCCCCAGATCTCAACGTCCACGTTGTATGTGTGACCGTGGATCCTGAGGCACTTGCTGTCATAGGGCAAA GCCAGAAAGTGTGAGCTGTCGAAGTCCTTGTGCCAGCCTATCTTTCTCTCACCGACCTTGAAGTCCATTCCCATCACCGG TTGAAGTTCTCCGGGACGGTTATAACCCTTGTGAGGGCAGTT