tg1865

Coordinates:1795113-1795574

>tg1865 6-pyruvoyl tetrahydrobiopterin synthase (PTPS)
MGMDFKVGERKIGWHKDFDSSHFLALPYDSKCLRIHGHTYNVDVEIWGGLNENGMIFDFNHLSNLVKELDHRILVSEAWV
VGMDGGVVIVEKNGKRLELPEGEVVILNKPNVTAEYIAEWFAERIAEKAGKNVKRILVRIWEDPRSYAEIILER

>tg1865 6-pyruvoyl tetrahydrobiopterin synthase (PTPS)
atgggaatggacttcaaggtcggtgagagaaagataggctggcacaaggacttcgacagctcacactttctggctttgcc
ctatgacagcaagtgcctcaggatccacggtcacacatacaacgtggacgttgagatctggggcgggctgaacgagaacg
gtatgatcttcgatttcaaccacctgagcaatcttgtcaaggagcttgaccacaggattctggtgagcgaggcgtgggtt
gtcgggatggacggaggagttgtcatcgttgagaagaacggcaagagactcgaactgccagagggagaggtagtgatcct
gaacaaacctaacgtcaccgcggagtacatagcggagtggttcgccgagaggatagctgagaaagcaggaaagaacgtaa
aacggatcctcgtgcggatctgggaggatccgaggagttatgcggagatcatccttgaacgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1794613 - 1796074 (Additional range around tg1865 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCGCGGAGCTTGCCGGGAAGCGCTTCATCGCGGCCGACGTCCAGGGTTTTATCCGCGAGCCTGCACCGGGTTCACTGCG CCTGAAACCGATCGATGGGGCGTTTTTGAAGGGAGTGCGTGTTCTTCATGCCGACCTGACCGAGTTCGAGTACGTCAAAG GACTAAGCCCCTCGGACGTCGAGGTTCTCCTGCTCTCCGATGGACCAAACCCGGGAATTGCGTACTTCATGGGGAAGAAG TACAGGTTTAAGCCCGTAAGGGTGAACGTGCCTGAGTCCACAGGGGCGGGGGATGTCTTCCTGGCCTCCTTCTCTTACTT TCACATGAGGTGTCCATTCGTACAGGCCCTAAAGAGGGCAATTGCCTTTACCGCGCTGTTCCTGGAGAGGAGGAACTTCG ATGCGACAGACGGGGAGATAGGGGAGATGGCCATGAAGGTCAGCGTGGAGAAACTGCCCTCACAAGGGTTATAACCGTCC CGGAGAACTTCAACCGGTG atgggaatggacttcaaggtcggtgagagaaagataggctggcacaaggacttcgacagc tcacactttctggctttgccctatgacagcaagtgcctcaggatccacggtcacacatacaacgtggacgttgagatctg gggcgggctgaacgagaacggtatgatcttcgatttcaaccacctgagcaatcttgtcaaggagcttgaccacaggattc tggtgagcgaggcgtgggttgtcgggatggacggaggagttgtcatcgttgagaagaacggcaagagactcgaactgcca gagggagaggtagtgatcctgaacaaacctaacgtcaccgcggagtacatagcggagtggttcgccgagaggatagctga gaaagcaggaaagaacgtaaaacggatcctcgtgcggatctgggaggatccgaggagttatgcggagatcatccttgaac gc TAACCCTTCCGGAACAGCGATCCCTGATTTTCTTCAGCATCTCACTACTTTTTTCGGTCAGATCCTTGAAGTACCCC TCTGGAAACGTCCCCGCCGCCTCCTCTGCGAGCCGGTTAATTAGCGTAAGGTAGGCGAGGGCGAGCTCACAGTCCTCCTC TTCTGAGATCACTCTGGCCATGTCCACAATGTAACCCACGAAGTTGTGAAGGAGCAGCTTCCACTGGTTTTCAAAACCGT TTTCGTTGAGCCAGCCCTTAAGGGTGAGGAAAAGCTTGATCGCGGGTTTAATTACATCTCTGTCCCCGTACCGCCGGTAT CTGATCATCAGGTACTGAAAGACCGACAGCAGAAAGTTTCCAACGACAGCTTTCCCCAGCCCCCTCGCTGCAACAAACTC CTCGAACTCCCTCAGGCCTCTCCCGCCGCTTTCAGCGAACGAAACTGCCAGGCTTAGGTACTGGCTCGAATACCTGGAGA AATCGACGTCCTCAAGCTCCACA