tg1872

Coordinates:1801726-1802418

>tg1872 hypothetical protein TGAM_1872
MIALALGLIVGLGLAFLLGKVKGRKSEVATTLAVPLMVYEVAEGIYGGWSGNVFIATPLGDFTPKEIIGLETFLALLVVL
VCVHFRVRGTFEIDGFIGFSTFFWAMVGFGIGLSASGWSLLAIPGLILWGILMWISRRNSLVGLRATPCTDGLSELVSES
DLRCLTDEESLGVYRINGYLLVGGKIGNFPQWREIVRCIAMAPEQRTVQGVIIGLIYLLPVRQGLFWETVS

>tg1872 hypothetical protein TGAM_1872
atgatagcgcttgcactcggcctgattgttggccttgggctcgcgttcctgcttggaaaagtgaagggcagaaaatcaga
ggtggcaacgacactcgcggttccgttgatggtatacgaagttgcagagggcatttacgggggctggagcgggaacgttt
tcattgcaactccccttggagatttcacgcctaaagagataatcgggctcgaaactttcttggcgcttcttgtggttctc
gtttgcgttcacttccgtgtgagagggacctttgagatagacgggttcataggattctcaacgtttttctgggcaatggt
tggatttggaattggtctctccgcaagcggctggtccctgctggccattccgggacttattctatggggaatccttatgt
ggatctcgcgaaggaactctcttgtaggtctaagggctacgccctgtacggacgggctgagtgaactggtcagtgaaagt
gacctcagatgcctcactgacgaggaaagcctgggagtttacagaatcaacggctaccttctcgtgggcgggaaaattgg
aaactttccccagtggagggagattgttaggtgcattgcgatggccccagagcagagaactgtccaaggggtgataattg
ggctcatctacctccttcccgtccggcagggattattctgggagacagtatcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1801226 - 1802918 (Additional range around tg1872 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCTGTCTATCTTGTTGGCGGCGACTATGAAGGGTGTTCTGTAACGCCTCAGTATCTCAATGCTCTCTATGGTCTGAGGC TGAAAGCCCTCGTTAATGTCCACAACGAGAACGGCCAGATCGGCTAAGCTACCTCCCCTCGCGCGCAAACTCGTAAACGC CTCGTGGCCGGGCGTGTCTATGAAGAGCAGGCCGGGGAGCTTTATCTCGCCCTTCCAGAGCTTTATGAGCGGTCCGGCGA GCTTCTTAACGACGTCAATCGGGACCTCCGTCGCTCCGATGTGCTGGGTTATTCCACCCGCTTCTTTGCCAGCGACGTTT GTTTTCCTTATCCGGTCGAGGAGCGTCGTTTTTCCGTGATCCACGTGCCCGAGAACCGCTATGATCGGCTGCCTAATCCT TTTGGTCATTTCCATCACCTGAGCATAACTCATGACTGGCCTTTTAAAGGGTTCGGGGCAAGGATTAAAAAGCCCCATAG TAACTCCAAACGGTGGTGGG atgatagcgcttgcactcggcctgattgttggccttgggctcgcgttcctgcttggaaa agtgaagggcagaaaatcagaggtggcaacgacactcgcggttccgttgatggtatacgaagttgcagagggcatttacg ggggctggagcgggaacgttttcattgcaactccccttggagatttcacgcctaaagagataatcgggctcgaaactttc ttggcgcttcttgtggttctcgtttgcgttcacttccgtgtgagagggacctttgagatagacgggttcataggattctc aacgtttttctgggcaatggttggatttggaattggtctctccgcaagcggctggtccctgctggccattccgggactta ttctatggggaatccttatgtggatctcgcgaaggaactctcttgtaggtctaagggctacgccctgtacggacgggctg agtgaactggtcagtgaaagtgacctcagatgcctcactgacgaggaaagcctgggagtttacagaatcaacggctacct tctcgtgggcgggaaaattggaaactttccccagtggagggagattgttaggtgcattgcgatggccccagagcagagaa ctgtccaaggggtgataattgggctcatctacctccttcccgtccggcagggattattctgggagacagtatcg TGACA GCACTGGCACTTCTGATTCTGGCGGTGTTAGACTACCTCACCGTGGCGTTTCTGAGCGTTAGGGTGTTTCAAAGGGCTCT TCCCGAGGACTGCAGGGAGGTGATGGACGAATACAAGAAGTTCATTAAGGAGAGCAAGAAAAGGGAAGGAAAACGGGTTA TTGCCTGATATCACCTCTCAAGACAGTCCATAGCGTCGAGGTACTCCTTTTTGGCCCTCGCGTGTGTATGATAGAACCAG TCGGAAGCTTTGCAGTAGCTGTAGAGCTCCTCCGGCTTGAAGTAGAGGTTTATTTCCCTTTCGGCGCTCTCGGGGCTGTC TGAGGCATGGATGACGTTGTATATTGCATCCCCAACGTCGAGGCCGTAGTCCCCCCTGATGCTCCCGGGTTCGGCGTCCT TTGGGTCCGTCGCTCCGGCCATCTTCCTGACGACGCTTATGGCGTAGCGCCCTTCGACTACCATCACGACGCTCGGGGCC TTTGTGATGTAGTC