tg1873

Coordinates:1802597-1803127

>tg1873 Nucleoside diphosphate kinase (ndk)
MLPMAESKVERTLVILKPDAVVRGLMGEIISRFEKRGLKIVGMKMIWIDRELAEKHYEEHRGKPFFEALIDYITKAPSVV
MVVEGRYAISVVRKMAGATDPKDAEPGSIRGDYGLDVGDAIYNVIHASDSPESAEREINLYFKPEELYSYCKASDWFYHT
HARAKKEYLDAMDCLER

>tg1873 Nucleoside diphosphate kinase (ndk)
gtgttgccgatggccgagagcaaggtcgaaagaaccctcgttatcctgaagcctgacgccgttgtccgggggctgatggg
cgaaatcataagccgttttgagaagaggggccttaaaatcgttggaatgaagatgatatggattgaccgcgagctcgctg
aaaagcactacgaggagcacaggggaaagcccttcttcgaggcgctgatagactacatcacaaaggccccgagcgtcgtg
atggtagtcgaagggcgctacgccataagcgtcgtcaggaagatggccggagcgacggacccaaaggacgccgaacccgg
gagcatcaggggggactacggcctcgacgttggggatgcaatatacaacgtcatccatgcctcagacagccccgagagcg
ccgaaagggaaataaacctctacttcaagccggaggagctctacagctactgcaaagcttccgactggttctatcataca
cacgcgagggccaaaaaggagtacctcgacgctatggactgtcttgagagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1802097 - 1803627 (Additional range around tg1873 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGCGACGAAGGATACCCGGCTGAGGTCATCGAGATCGTTGCAAGGACCGGTGTCACCGGCGGCGTTACTCAGGTCAAGG TTAGGATACTCGAGGGACGCGACAAGGGTCGTGTCATCAGGAGGAACGTTAAAGGGCCAGTTCGCGTTGGCGATATAGTC ATCCTCAGGGAGACTGAGCGTGAGGCGAGAGAGATCAGGAGGAGGCGCTGAAAATGGCCCGCTGGAACGTCTGCTCCTAC TGCGGAAGGGAGTTCGAGCCGGGAACGGGCAAGATGTTCGTCAGGAACGACGGCAGAGTCCTGTTCTTCTGCTCCAGCAA GTGCGAGAAGCTCTACTTCATGGGGCGCAATCCGAGGAAGCTCAAGTGGACCAAGGCCTTCCAGGAGGCCAGACTCCAGA GGGCCAAGAGGAGGAAGTGATTTCTTTCTTTTTAATCCTTTCAACCGTTTCTGCTACGACCCAAAAAACCTATTAACCGC GTACCCCATTCTATAAGCG gtgttgccgatggccgagagcaaggtcgaaagaaccctcgttatcctgaagcctgacgcc gttgtccgggggctgatgggcgaaatcataagccgttttgagaagaggggccttaaaatcgttggaatgaagatgatatg gattgaccgcgagctcgctgaaaagcactacgaggagcacaggggaaagcccttcttcgaggcgctgatagactacatca caaaggccccgagcgtcgtgatggtagtcgaagggcgctacgccataagcgtcgtcaggaagatggccggagcgacggac ccaaaggacgccgaacccgggagcatcaggggggactacggcctcgacgttggggatgcaatatacaacgtcatccatgc ctcagacagccccgagagcgccgaaagggaaataaacctctacttcaagccggaggagctctacagctactgcaaagctt ccgactggttctatcatacacacgcgagggccaaaaaggagtacctcgacgctatggactgtcttgagagg TGATATCA GGCAATAACCCGTTTTCCTTCCCTTTTCTTGCTCTCCTTAATGAACTTCTTGTATTCGTCCATCACCTCCCTGCAGTCCT CGGGAAGAGCCCTTTGAAACACCCTAACGCTCAGAAACGCCACGGTGAGGTAGTCTAACACCGCCAGAATCAGAAGTGCC AGTGCTGTCACGATACTGTCTCCCAGAATAATCCCTGCCGGACGGGAAGGAGGTAGATGAGCCCAATTATCACCCCTTGG ACAGTTCTCTGCTCTGGGGCCATCGCAATGCACCTAACAATCTCCCTCCACTGGGGAAAGTTTCCAATTTTCCCGCCCAC GAGAAGGTAGCCGTTGATTCTGTAAACTCCCAGGCTTTCCTCGTCAGTGAGGCATCTGAGGTCACTTTCACTGACCAGTT CACTCAGCCCGTCCGTACAGGGCGTAGCCCTTAGACCTACAAGAGAGTTCCTTCGCGAGATCCACATAAGGATTCCCCAT AGAATAAGTCCC