tg1874

Coordinates:1803210-1803413

>tg1874 LSU ribosomal protein L24E (rpl24E)
MARWNVCSYCGREFEPGTGKMFVRNDGRVLFFCSSKCEKLYFMGRNPRKLKWTKAFQEARLQRAKRRK

>tg1874 LSU ribosomal protein L24E (rpl24E)
atggcccgctggaacgtctgctcctactgcggaagggagttcgagccgggaacgggcaagatgttcgtcaggaacgacgg
cagagtcctgttcttctgctccagcaagtgcgagaagctctacttcatggggcgcaatccgaggaagctcaagtggacca
aggccttccaggaggccagactccagagggccaagaggaggaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1802710 - 1803913 (Additional range around tg1874 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAGGACGTTGACCCCGAGGAGATAGTTGCCCACCTTCCGCCGCTCTGTGAGGAGAAGGAGATCCCGTACATCTACGTTC CGAGCAAGAAGGAGCTCGGTGCGGCCGCCGGGCTTGAGGTCGCCGCTGCGAGCGTGGCAATAATAGAGCCCGGCAAGGCC CGCGAGCTCGTTGAGGACATTGCTATGAAGGTCAAGGAGCTCATGAAGTGAGCTCCTTTTCCTTCCTTAATCACGAAAGG TTTAAGTTCATCTCGCGAGCTTGAGTTTTAAAGGGGTGTGAGGTATGAGCGACGAAGGATACCCGGCTGAGGTCATCGAG ATCGTTGCAAGGACCGGTGTCACCGGCGGCGTTACTCAGGTCAAGGTTAGGATACTCGAGGGACGCGACAAGGGTCGTGT CATCAGGAGGAACGTTAAAGGGCCAGTTCGCGTTGGCGATATAGTCATCCTCAGGGAGACTGAGCGTGAGGCGAGAGAGA TCAGGAGGAGGCGCTGAAA atggcccgctggaacgtctgctcctactgcggaagggagttcgagccgggaacgggcaag atgttcgtcaggaacgacggcagagtcctgttcttctgctccagcaagtgcgagaagctctacttcatggggcgcaatcc gaggaagctcaagtggaccaaggccttccaggaggccagactccagagggccaagaggaggaag TGATTTCTTTCTTTT TAATCCTTTCAACCGTTTCTGCTACGACCCAAAAAACCTATTAACCGCGTACCCCATTCTATAAGCGGTGTTGCCGATGG CCGAGAGCAAGGTCGAAAGAACCCTCGTTATCCTGAAGCCTGACGCCGTTGTCCGGGGGCTGATGGGCGAAATCATAAGC CGTTTTGAGAAGAGGGGCCTTAAAATCGTTGGAATGAAGATGATATGGATTGACCGCGAGCTCGCTGAAAAGCACTACGA GGAGCACAGGGGAAAGCCCTTCTTCGAGGCGCTGATAGACTACATCACAAAGGCCCCGAGCGTCGTGATGGTAGTCGAAG GGCGCTACGCCATAAGCGTCGTCAGGAAGATGGCCGGAGCGACGGACCCAAAGGACGCCGAACCCGGGAGCATCAGGGGG GACTACGGCCTCGACGTTGGGGATGCAATATACAACGTCATCCATGCCTCAGACAGCCCCGAGAGCGCCGAAAGGGAAAT AAACC