tg1890

Coordinates:1814598-1815383

>tg1890 hypothetical protein TGAM_1890
MGGAVIGFTHVFVGIGGAGSKVVNEITVDSIKVNINPGRYLLRTEEYMRRVPLFFSTVPEDSIVWILTEDKPINVEILRL
IIDSIPEGATRLAYVFTPARELVKEKKPQWAGLFDTVFYDSLWEFFDERKPLSEAYKEASGSIARALSSLIRNLEGQMLI
NVDYADFFSVVRGGNVGIIRLLRSVDLSWHWGIWDRGIIMTLARDDVALREAHQILEMFQGILRKKDIIWGMVTDKDIKN
RMEVIALLVKEWGEGNDKGGAL

>tg1890 hypothetical protein TGAM_1890
ttgggaggagcggtgataggctttacacacgtttttgttggaataggtggggccggttcgaaggtggttaatgaaataac
tgtggattccattaaggtgaacataaaccccggtagataccttctgagaaccgaggagtacatgagaagggttcccctct
tcttctcgaccgttcccgaggactcgatagtctggatcctcacggaggacaaaccaatcaacgtggagatactcaggttg
atcatcgatagcattcctgagggtgccacgcggctggcctacgttttcacgcccgcgagggaactcgttaaggaaaagaa
accgcaatgggcggggctttttgacacagtcttttacgattccctctgggagttctttgacgagaggaaacctctgagcg
aggcctacaaggaagcatcgggatcaatagcccgggccctcagctcactcatccggaacctggaggggcagatgctcata
aacgtcgactacgcggactttttctcggtggtcagggggggcaacgttggaataataaggctcctgcggagcgtggatct
cagctggcactgggggatctgggacagggggatcatcatgaccctcgcccgagacgacgttgctctgagggaagcccatc
aaatcctcgagatgttccaggggatactgaggaagaaggacatcatctgggggatggtgacggacaaagacattaaaaac
aggatggaggtaatagcacttctcgttaaggagtggggtgaaggcaatgataaaggcggtgctctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1814098 - 1815883 (Additional range around tg1890 is :500nt.)

>Thermococcus gammatolerans EJ3 GATATTCATCTACGGCGCGGGAAGGAGCGGTCTGGTCGGCAAGGCCTTCGCGATGAGGCTCATGCACCTTGACTTCAACG TCTACGTCGTCGGCGAGACGATAACACCAGCCTTCGAGCCGGGGGATCTGCTCATAGCCATCAGCGGCTCCGGTGAGACC CAGAGCATAGTAGATGCCGCCAGGATAGCCAAGGAGCAGGGGGGCAAGATAGCGGCGATAACATCCTATGCCAACTCAAC TCTCGGAAAACTGGCCGATGTCGTCGTTGAGATCCCCGGAAGGGCGAAGACGGACGTTCCAACTGATTACATAGCGAGGC AGATGCTCACCCAATACAAGTGGATCGCACCGATGGGAACCCTCTTCGAGGACTCAACCATGATATTCCTCGACGGAATA ATAGCCCTCCTGATGGCAACGTTCCAGAAGACCGAGAAGGACATGAAGAGAAAGCACGCGACCCTCGAATGATTTATTAA CTCCTTTTCCCTCTCCATA ttgggaggagcggtgataggctttacacacgtttttgttggaataggtggggccggttcg aaggtggttaatgaaataactgtggattccattaaggtgaacataaaccccggtagataccttctgagaaccgaggagta catgagaagggttcccctcttcttctcgaccgttcccgaggactcgatagtctggatcctcacggaggacaaaccaatca acgtggagatactcaggttgatcatcgatagcattcctgagggtgccacgcggctggcctacgttttcacgcccgcgagg gaactcgttaaggaaaagaaaccgcaatgggcggggctttttgacacagtcttttacgattccctctgggagttctttga cgagaggaaacctctgagcgaggcctacaaggaagcatcgggatcaatagcccgggccctcagctcactcatccggaacc tggaggggcagatgctcataaacgtcgactacgcggactttttctcggtggtcagggggggcaacgttggaataataagg ctcctgcggagcgtggatctcagctggcactgggggatctgggacagggggatcatcatgaccctcgcccgagacgacgt tgctctgagggaagcccatcaaatcctcgagatgttccaggggatactgaggaagaaggacatcatctgggggatggtga cggacaaagacattaaaaacaggatggaggtaatagcacttctcgttaaggagtggggtgaaggcaatgataaaggcggt gctctt TGACATAGATCACACTTTGCTCACGGAGATGCCCCTCATCCAGCTCTTCCTTCCGCAGGTGTACGAGAAGATC TCAAAAAAACTGGGGATAAACAAGGAGGAGGCGAGAAAGAAATTCCTTAACGAGATCCTCGGAAGGAGGGAAACCTACGA GTGGCACGACTGGAACTTCTTCTTCCGGCTCTTTGACCTTGATCTGAGGTACGAGGATCTGCTGAGGAAGTACCCTCACA AGCTTCACGTCTATCCGGACACCGTTCCAGTCCTCAGGTGGCTGCGAGAGGAGGGCCTAAAGCTGGGCATAGTCACCAGC GGGCCCGCTTACCAGAAGCTCAAACTGGAACTGACCGGCCTGGATGGGTACTTTGATACGGTGATCACGAGGGACGACGT GAACGCCATAAAACCCGAGCCGAAGATCTTCCTCCGGGCCCTAGAGGATCTTGGTGTGCGTCCCGAAGAGACAATTATGG TGGGGGATTCCCTCTGGCAGGACGTGT