tg1909

Coordinates:1832934-1833791

>tg1909 hypothetical protein TGAM_1909
MKVHYECFSCIASQCQKIVEMGTEDLGVRKRGILRAAKGIAEMKEDSIPAVIGSRVFLEVYDAIGNDDPFREYKELSNRL
AEKVVSDLERENIDLKTALKLAIIGNVIDFAVGYSPERIEEDVRAMLGEELYIDNSDELFNRLSRAKILLYLTDNCGEIY
FDRLFLRKIREEFPQLKIYIAGKEGPIINDATVEDLRRAGLEEIGEVISTGTRIVGVPFGLVSREFMEVFEKADVIIAKG
QGNFETLSERKDGRIFYLLKAKCRPIARELNVPQGSLLCVRSPFGP

>tg1909 hypothetical protein TGAM_1909
atgaaggttcactacgagtgcttctcgtgcattgccagtcagtgtcaaaagattgtcgaaatgggaaccgaagaccttgg
tgtcaggaagagaggtattttgagggccgcgaaggggatagctgagatgaaagaagactccatacccgcagtgatcggga
gcagagtattccttgaggtttatgatgccattgggaacgacgatccgttcagggagtacaaggaactctcgaacaggctg
gctgagaaagtcgtctctgatctcgaacgggaaaatatcgaccttaagaccgcactaaagctcgccataattggcaacgt
gatagacttcgccgtcggctactcccccgagaggattgaggaggacgttagggcaatgctcggggaagagctctacatcg
acaactccgatgaactcttcaataggctgagtagggcaaagatcctcctctacctcacggacaactgcggcgagatatat
ttcgacaggctgttcctcaggaagattcgggaagagtttccccaattgaagatctacatcgccggcaaggagggaccgat
aataaacgacgccaccgttgaggatctcaggcgagcgggccttgaggagattggcgaggtaatctcgactgggacgagaa
tagtcggtgtgccctttggccttgtttctcgggagttcatggaggtcttcgagaaggcggacgtaataatagccaaggga
caggggaactttgagaccctgagcgagaggaaagatgggaggattttctacctcctgaaggccaagtgccggccgatagc
gagggaactaaacgtgccccagggctcgttgctttgcgttcgctctcccttcgggcct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1832434 - 1834291 (Additional range around tg1909 is :500nt.)

>Thermococcus gammatolerans EJ3 TTTGGTATCTCTCGAGGGAAAACTTTATAAATCCTCCTCGACCCTTATAATTGGCAACGCGGGGGTTGCCGAGCCTGGTC AAAGGCGCGGGATTGAGGGTCCCGTCCCGCAGGGGTTCCGGGGTTCAAATCCCCGCCCCCGCACCAGAAACGAAACTTTT GCCAAGCAAAAGTTTCATCAAAGTTCGTGATTCCTTTTTGAAGAGTAGTTTTTGAGTGGATTTCCCCCAAATTGCTCCTT TGACTGAACGAATTCATTTAAAAGCACCTTTTAGCTTGGGTTCAAGCTTTTTTGCGCTCTGGTGGGGCGCGGTTCTACCT GAACCGCGCATAAAAAGCCTTAACTTGGTGAATTCAAACTTTCAATAGCGGGCTTGATTTTGAAATCCTATTACAAAGGA GCCCAAAAGAGGAATCACGAACTTCTAGCCAAACTTTTCCCAAAAGCTTGCCTGCGAAAGCGATTTAAATCGCTGGATCA TGAAGATAGCGGTGGTGGA atgaaggttcactacgagtgcttctcgtgcattgccagtcagtgtcaaaagattgtcgaa atgggaaccgaagaccttggtgtcaggaagagaggtattttgagggccgcgaaggggatagctgagatgaaagaagactc catacccgcagtgatcgggagcagagtattccttgaggtttatgatgccattgggaacgacgatccgttcagggagtaca aggaactctcgaacaggctggctgagaaagtcgtctctgatctcgaacgggaaaatatcgaccttaagaccgcactaaag ctcgccataattggcaacgtgatagacttcgccgtcggctactcccccgagaggattgaggaggacgttagggcaatgct cggggaagagctctacatcgacaactccgatgaactcttcaataggctgagtagggcaaagatcctcctctacctcacgg acaactgcggcgagatatatttcgacaggctgttcctcaggaagattcgggaagagtttccccaattgaagatctacatc gccggcaaggagggaccgataataaacgacgccaccgttgaggatctcaggcgagcgggccttgaggagattggcgaggt aatctcgactgggacgagaatagtcggtgtgccctttggccttgtttctcgggagttcatggaggtcttcgagaaggcgg acgtaataatagccaagggacaggggaactttgagaccctgagcgagaggaaagatgggaggattttctacctcctgaag gccaagtgccggccgatagcgagggaactaaacgtgccccagggctcgttgctttgcgttcgctctcccttcgggcct T AGGTGGGCCTTTTCTCTTCCTCTGGAAACTTCCAGTTTTTCGTGATCCTGGCAACGTTTCTGATCAGCGTTCTCTCATCT CGGTTCTTCTCGACCAACTTTTCAAGGAAGGAGACGAGCTCATCGTAGGTTCTCTTCTCAACTGGGAACGGCACGCGGTC CTTTCCGCCGACCGCGTAGGTGAACTTGAAAGGATCGACCGGATGGGTAACCCTGTCCCTCCAGCTGGGTGGCGTCTCGT AGACCAGCTCCACAACTAGCGATAGTGCCCTGAGCGTGCTCGGACCTAGGCCCTTGAGGAGTAGAAGCTCCTCATAGTTC CTAACCCCCAGTTCCCTCGCGAATTCAAGTGCCTTCCTGTTGAGCTCCAGTTTTCCAAGGCTTTCGTAACGCCTCAGAAC GGTTACCTCATCGACGTTCCTCGGGCGATAGTAGACCAATGGACGGTAGCCCTTCGCTATGGCCTTTATGGTTTCAAATT CCCGTTCAATTTTCTCGGG