tg1912

Coordinates:1837038-1837286

>tg1912 Molybdopterin synthase, small subunit, moaD-like protein (moaD)
MVKVKVFATLIDIVGKRMLEIGGVKTVGELLDELDRRFPGVKKELEDGYLILVNGKNIEHLQGLETPISDDDTVSVFPPA
GGG

>tg1912 Molybdopterin synthase, small subunit, moaD-like protein (moaD)
atggtaaaagttaaggtgttcgccactctcatcgacatcgtgggaaagcgaatgcttgaaatcgggggcgttaaaaccgt
tggggagttgttggatgaactcgatcggcggtttccgggggtcaaaaaggaactcgaagacggctacctgattctcgtta
acggtaagaacatcgaacaccttcagggactggaaactcccatttcagatgacgatacggttagcgtttttccaccggcg
ggaggcggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1836538 - 1837786 (Additional range around tg1912 is :500nt.)

>Thermococcus gammatolerans EJ3 TACAAGATGGATCCGCACGACATAAGCGACGACAAGATCAAGATGCTCATACTCTTCCAGGATCTCAGCGCCCTCATAGA CGCCGCCGGTTTGTGTCTGTTCACGACCTTTGGACTCGGCGCCGACGACTACCGCGACATGCTCAACGCGGCCCTTGGCT GGGACTTCTCAACTGAGGACTACCTCAAGGTCGGAGAGAGAATATGGAACGCCGAGAGGATCTTCAACCTCAAGGCCGGC CTCGATCCGCTTAAGGACGACACCCTGCCGAAGCGCTTCCTCGAGGAGCCGATGCCGGAGGGACCGAACAAGGGACACGT TGTCAGGCTCAAGGAGATGCTGCCGCGCTACTACCAGCTCCGCGGCTGGACCGAAGATGGAAGGGTTCCGCCGGAGAAGG CCGAGGAGCTCGGCATCAAGGAGTTCCTCTGATTTTCCCATTTTTGTCCAGCAATTTTTTAATAGCTTCACGCTGAGGAA CTTGTTCAGGTGACGTTGT atggtaaaagttaaggtgttcgccactctcatcgacatcgtgggaaagcgaatgcttgaa atcgggggcgttaaaaccgttggggagttgttggatgaactcgatcggcggtttccgggggtcaaaaaggaactcgaaga cggctacctgattctcgttaacggtaagaacatcgaacaccttcagggactggaaactcccatttcagatgacgatacgg ttagcgtttttccaccggcgggaggcggt TGAAGTGGTGAAGGAAGTCGGCAAAGAGTACACCTTCACTCTGTGGGACG GGAAGGTAATAGTCAGACCGAAGCTCGACATGAAGTACCTGTACATAGAAGTAACCAGCAGGTGCAACCTGAAGTGCGAG ATGTGCTTCAAGCAGTACTGGGAAGATAAAGAGGGGGATATGGACTGGGACCTCTTCCTCAAGATACTCGACGACGCGGA GGAGTTTCCAGAGCTCAGAATGATCTACTTCGGAGGGATAGGTGAGCCTTCCGTCCACCCGCGCTTCATGGACATGGTCC GGGAAGTTAAGAGGAGGGGGTTTGCCCTCGGGATGAGCACGAACGGAACCCTGCTGACGGACAAAATGCTCCGAGAGATA TCTGAGCTTGGGGTTGAGCTGGTATACTTTTCCATGGACACCGTGCCAACGGCCCAGAACGCGATAACACTCGGTCACAT TGCCGCGGCGGTTACAGCGGACAAGATAAGGAAGCTCGTGAAATACCGGG