tg1918

Coordinates:1843278-1843640

>tg1918 Nucleotide binding protein, putative, containing PIN domain
MNVYVDVNVLYYFLTANEEFGERARDLLERYSGNVMTSALTVWQLYILFRRQKTKLNITDILLDLGIEVVPLTMEILRNA
ERCKKLDFDDAIHYATMKAHGITTILSNDRDFDKVDVKRIF

>tg1918 Nucleotide binding protein, putative, containing PIN domain
gtgaatgtttatgttgacgtgaatgttctgtattatttcctcacagccaacgaggagttcggagagcgtgcgagagacct
gcttgagagatacagcggaaacgtgatgacctcagcccttacagtatggcaactttatattctgtttaggaggcaaaaga
ctaagttgaacatcactgatatacttctggatttgggaattgaggtagttcccttaaccatggaaatccttaggaatgcc
gaaagatgcaaaaagctcgatttcgacgatgccattcattatgcgacaatgaaagcccacggaataacaacaatcctatc
aaacgatagggattttgataaagttgatgtgaaaagaatcttc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1842778 - 1844140 (Additional range around tg1918 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGAAGAACATCGCCCTCGGTGCAAGCATAAAGTGCTACCGCAACAAGACCACCTACGCCCAGGCCCTCGCCGAGGAGAT CATTGCCGCCGCCAACAGGGATCCGAAGAGCTTCGCCTACAGTAAGAAGGAAGAGATCGAGAGGATTGCCCAGTCCTCCC GCTGAGGGCTGTTTCCTGTTCTCATTCTCTCTTCAGTTTATATATTACTGCTTCCGTTGTTGCCAAAAATTATTTATTGT CCAAAATTCAACAACATAGCATGACAACTGAAATTGTCAAACTAGACAAGAATGGAAGGATATATCTTCCTGCATCCCTG CGGAAGAAATTTGGGACCAGCTCTTTCTACGTTGAGGAAAGGGGGGATGAGATAGTTCTTATCCCGGTTCGCAAAAAAAT CAGGAAGTACTACGGAGTATTCAAAGGTGAGAATCTAAGTGCGGAAGAGATTGACCAGTTAATTGAAGAGGAAACAGAGC AACTTCTGAGGGATGAGCT gtgaatgtttatgttgacgtgaatgttctgtattatttcctcacagccaacgaggagttc ggagagcgtgcgagagacctgcttgagagatacagcggaaacgtgatgacctcagcccttacagtatggcaactttatat tctgtttaggaggcaaaagactaagttgaacatcactgatatacttctggatttgggaattgaggtagttcccttaacca tggaaatccttaggaatgccgaaagatgcaaaaagctcgatttcgacgatgccattcattatgcgacaatgaaagcccac ggaataacaacaatcctatcaaacgatagggattttgataaagttgatgtgaaaagaatcttc TAAACTCATACCCGCA CGAATAAGAACGTTGATGTCAATTAAAAATCCCTCCCCCATTCTTCCCTCAGCCCCCTGAGGCTCCTCTCAAGGTTTTTC TTTTCCCTGTAAATCCCGCGGTACTTCGATGGCTCAAAGAACTCGACCTTAATCTTCTCCCAGAGTTCAGGAGGAATTAT GACGTCCTTAATCTCCCGTGCTCGTCGTAAATGTACTCAATACCTCTATACCACACCTGAAGGGGTTTTGTTCCGCGCCT ATTTAACCCCTTCGCCCTGCATGCTTCGCAAGGTCAGAGATTTTTTCGGGCTTTCGCCTTCATCTCCAGTTATCGGGTGC AAAAGGGTAGCTGGAAAACTATTTAACTTCAAGGCTTATCCAAAATCGGTGAGAGAATGAGCGAAGTTATCAATCCTCAT GTGCTCCTCCAGAAAATAGACCACATAGAGAAAGAACTGGAGGACTTAAAGATCATGCTGCTCAAGATGGTCGCCGAAAA CCTC