tg1920

Coordinates:1843978-1844622

>tg1920 SSU ribosomal protein S7P (rps7P)
MAKPLTERFFIPKELKVFGRWSVEDVTVNDPSLRPYIALEPRILPHSHGRHAKKPFGKAQVHIVERLINKVMRSGASHYK
AGGHFMRREHRSIMSKKMKAYEVVKEAFMIIERRTKQNPIQVLIRAIENSAPREDTTTIAFGGIRYHMAVDVSPLRRLDV
ALKNIALGASIKCYRNKTTYAQALAEEIIAAANRDPKSFAYSKKEEIERIAQSSR

>tg1920 SSU ribosomal protein S7P (rps7P)
atggccaaacccctcaccgagcgctttttcatcccgaaggagctcaaggtctttggaaggtggagcgttgaggatgttac
agtcaacgacccctcgctcaggccttacatagccctcgagccgaggatcctcccgcacagccacggcaggcacgcgaaaa
agccctttggcaaggcccaggttcacatcgttgagcgtttgattaacaaggtcatgaggagcggtgccagccactacaag
gccggcggtcacttcatgagaagggaacaccgctcgataatgagcaagaagatgaaggcctacgaggtcgtcaaggaggc
cttcatgatcatagagagaagaaccaaacagaacccgattcaggttctcataagggccatcgagaactccgccccgaggg
aggacaccaccaccattgccttcggtggaatccgctaccacatggccgtcgacgtttccccgctcaggaggcttgacgtg
gccttgaagaacatcgccctcggtgcaagcataaagtgctaccgcaacaagaccacctacgcccaggccctcgccgagga
gatcattgccgccgccaacagggatccgaagagcttcgcctacagtaagaaggaagagatcgagaggattgcccagtcct
cccgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1843478 - 1845122 (Additional range around tg1920 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAGAGACACCACGGTATTAGCGATGTTGTGGTAATATGAGGTGATGATCATGGCTGGAAAGAAGGCCCCGTATGGTGAA TTTGCCGGTAGGAAGCTCAAGCTCAAGAGGAAGAAGTTCCGCTGGAGCGACATAAGGTACAAGAGAAGGGTTCTCCGCCT CAAGGAGAGGAGCGACCCGCTGGAGGGAGCTCCTCAGGCGAGGGGGATCGTCCTTGAGAAGATAGCCGTCGAGGCAAAGC AGCCGAACTCGGCCATGCGTAAAGCGGTTAGGGTTCAGCTCATCAAGAACGGTAAGGTCGTTACGGCCTTCACCCCCGGT GACGGTGCCATAAACCACATCGACGAGCACGATGAAGTCATCATCGAGGGAATCGGCGGTCCCAAAGGCGGTTCGATGGG TGACATCCCGGGAATCAGGTACAAGGTCGTTAAGGTCAACAGGGTTTCCCTCAAGGAGCTCGTCAAGGGAAGAAAGGAGA AGCCGAGGAGGTGAAGCGA atggccaaacccctcaccgagcgctttttcatcccgaaggagctcaaggtctttggaagg tggagcgttgaggatgttacagtcaacgacccctcgctcaggccttacatagccctcgagccgaggatcctcccgcacag ccacggcaggcacgcgaaaaagccctttggcaaggcccaggttcacatcgttgagcgtttgattaacaaggtcatgagga gcggtgccagccactacaaggccggcggtcacttcatgagaagggaacaccgctcgataatgagcaagaagatgaaggcc tacgaggtcgtcaaggaggccttcatgatcatagagagaagaaccaaacagaacccgattcaggttctcataagggccat cgagaactccgccccgagggaggacaccaccaccattgccttcggtggaatccgctaccacatggccgtcgacgtttccc cgctcaggaggcttgacgtggccttgaagaacatcgccctcggtgcaagcataaagtgctaccgcaacaagaccacctac gcccaggccctcgccgaggagatcattgccgccgccaacagggatccgaagagcttcgcctacagtaagaaggaagagat cgagaggattgcccagtcctcccgc TGAGGGCTGTTTCCTGTTCTCATTCTCTCTTCAGTTTATATATTACTGCTTCCG TTGTTGCCAAAAATTATTTATTGTCCAAAATTCAACAACATAGCATGACAACTGAAATTGTCAAACTAGACAAGAATGGA AGGATATATCTTCCTGCATCCCTGCGGAAGAAATTTGGGACCAGCTCTTTCTACGTTGAGGAAAGGGGGGATGAGATAGT TCTTATCCCGGTTCGCAAAAAAATCAGGAAGTACTACGGAGTATTCAAAGGTGAGAATCTAAGTGCGGAAGAGATTGACC AGTTAATTGAAGAGGAAACAGAGCAACTTCTGAGGGATGAGCTGTGAATGTTTATGTTGACGTGAATGTTCTGTATTATT TCCTCACAGCCAACGAGGAGTTCGGAGAGCGTGCGAGAGACCTGCTTGAGAGATACAGCGGAAACGTGATGACCTCAGCC CTTACAGTATGGCAACTTTATATTCTGTTTAGGAGGCAAAAGACTA