tg1922

Coordinates:1845085-1845519

>tg1922 Transcription termination-antitermination factor, NusA-like protein (nusA)
MPLKLNTDQIKYIALFESMTGATVLDCLIDANRNRLIFVIKKGEMGLALGKKGANVKRVQNMIGKDIELIEHSENPEEFL
RNIYKSLGVKVKKIHITEKRDGKKVALLDISPREKPRAIGRGGQNINLVKQLMERHHGISDVVVI

>tg1922 Transcription termination-antitermination factor, NusA-like protein (nusA)
atgccgctcaagctgaacacggaccagataaagtacatagcactcttcgagagcatgacaggggcaactgtgctcgactg
cctgatagatgccaacaggaacaggctcatcttcgtcatcaagaagggggaaatgggactggcactcggaaagaagggag
caaacgtcaagcgcgttcagaacatgatcggcaaggatatcgaactaatcgagcactcggagaatcccgaggagttcctg
aggaacatttataaaagcctcggggttaaggttaaaaagatccacatcacggagaagagagacgggaaaaaggtcgccct
cctcgatataagcccgcgcgagaaacctcgcgcgatcggaaggggcggccagaacataaacctcgtgaaacagctgatgg
agagacaccacggtattagcgatgttgtggtaata


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1844585 - 1846019 (Additional range around tg1922 is :500nt.)

>Thermococcus gammatolerans EJ3 TTTAGCAAGGGCGGCCTTCGAGATCACAACGCAGCACCTGTTCGAGGCCGCCGAGAGGGGAGAAGTCGATCCGCTCAACG GAGTCGTTGAGAACGTCCTCATCGGCCAGCCCGTGCCCGTTGGTACGGGAATCGTTAAGCTGACAATGAATCTCCCCCTG AGACCGCAAAGGGAGTAGGGAGGTGTAGTTGATGGTTGATTTCGCCTTTGAGCTTAGGAAGGTTCAAGATACCGGAAAGC TGGTCATGGGAGCGAAGAAGAGCATCCACTACGCCAAGGTCGGCGGGGCAAAGATGATTATCGTCGCGAAGAACGCGAGG CCGGACATCAAGGAGGACATCTACTACTACGCCAAGCTCAGTGGAATCCCGGTTTACGAGTTCGAGGGAACCAGCGTCGA GCTTGGAACGCTCCTCGGAAGGCCCCACACCGTTTCGGCTCTCGCGGTGATAGACCCCGGTGAGAGCAGGATACTCGCGC TTGCTGGGGGTAAGGAGTA atgccgctcaagctgaacacggaccagataaagtacatagcactcttcgagagcatgaca ggggcaactgtgctcgactgcctgatagatgccaacaggaacaggctcatcttcgtcatcaagaagggggaaatgggact ggcactcggaaagaagggagcaaacgtcaagcgcgttcagaacatgatcggcaaggatatcgaactaatcgagcactcgg agaatcccgaggagttcctgaggaacatttataaaagcctcggggttaaggttaaaaagatccacatcacggagaagaga gacgggaaaaaggtcgccctcctcgatataagcccgcgcgagaaacctcgcgcgatcggaaggggcggccagaacataaa cctcgtgaaacagctgatggagagacaccacggtattagcgatgttgtggtaata TGAGGTGATGATCATGGCTGGAAA GAAGGCCCCGTATGGTGAATTTGCCGGTAGGAAGCTCAAGCTCAAGAGGAAGAAGTTCCGCTGGAGCGACATAAGGTACA AGAGAAGGGTTCTCCGCCTCAAGGAGAGGAGCGACCCGCTGGAGGGAGCTCCTCAGGCGAGGGGGATCGTCCTTGAGAAG ATAGCCGTCGAGGCAAAGCAGCCGAACTCGGCCATGCGTAAAGCGGTTAGGGTTCAGCTCATCAAGAACGGTAAGGTCGT TACGGCCTTCACCCCCGGTGACGGTGCCATAAACCACATCGACGAGCACGATGAAGTCATCATCGAGGGAATCGGCGGTC CCAAAGGCGGTTCGATGGGTGACATCCCGGGAATCAGGTACAAGGTCGTTAAGGTCAACAGGGTTTCCCTCAAGGAGCTC GTCAAGGGAAGAAAGGAGAAGCCGAGGAGGTGAAGCGAATGGCCAAACCCCTCACCGAGCGCTTTTTCATCCCGAA