tg1932

Coordinates:1856317-1856967

>tg1932 Phosphotransferase, PHP family
MNMIHDAHTHTLHSDGLGEVFENIAEAERKGLSLVAITDHSHYLLRGNFNAYLSEIRRWGEDSEITVLAGIEGNITPNGV
DVPDWMAKKLDFVIASVHEWVDRPEQYVELVRVALLDENVDVIGHFGASFPYIGYPPWEDLLELITLAEENGKAFEISSR
YRVPDLEFVRECIRRGVKLTFASDAHRPEKVGNVGWSVSIFKKAGGKLEDLLFEEFL

>tg1932 Phosphotransferase, PHP family
ttgaacatgattcacgacgcccacacccacacgctccactcagatggcctcggtgaggtcttcgagaacatcgcggaggc
cgagcgaaagggcctttcgctcgtagctataacagaccacagccactatctcctgcgtggtaacttcaacgcctacctta
gcgagataaggcgctggggcgaggatagtgagataacggttttagctggaatcgagggcaacataacccccaacggcgtt
gacgtgccggactggatggccaaaaagctcgacttcgtgatagcaagcgttcacgagtgggttgaccggccggagcagta
cgttgagctcgtcagggttgcactcctcgacgagaacgtcgatgtaataggccatttcggggcaagctttccctacatag
gttatcctccttgggaggaccttttggagctcataacgctcgccgaggaaaatggtaaggccttcgagataagctcccgc
taccgcgttccggatctggagttcgtgagggagtgcataaggaggggcgttaagctgaccttcgccagcgatgcccacag
gccggaaaaagttggaaacgtcggctggagcgtgagcattttcaaaaaagctggaggaaagcttgaggatctgctgtttg
aagagtttctg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1855817 - 1857467 (Additional range around tg1932 is :500nt.)

>Thermococcus gammatolerans EJ3 GAACTCTATCACGGTCTTCAGAGGAGTTCCCGGGCCGAAGACCTCGGCGACGCCCATCTTCTTCAGCTCCTCGGCGTCGT CGGGCGGGATTATCCCACCCGCGAAGATTACGATGTCCTCGTTCGGCTTTATGCCCCTCTCCTCGAGGAGCTTGATAATC TTCGGAATCAGAACCATGTGCGCGCCGGAGAGGATGCTTATCCCAAGGACTGCGGCGTCCTCTTGGATGACCGTCTCGAC TATCTGCTCGGGGGTCTGCCTGATTCCCGTGTAGATAACCTCGTATCCTGCCTCCTTCAGGGCCCTCGCGACGACCTTGG CCCCCCTGTCGTGACCGTCAAGACCGGGCTTCGCTATGACGACGCGAACCTTTGAGCGCTCGACCATTGACACCACCGGG TAGGTTTCTCCCTTGTCGTATTTAAAGGTTGTCAAAACTCAAGGTTTAGCTTTACGTTGGATTTTTTGTCCACAAGCTTT TTTAAAGCCCCAGAATAGCC ttgaacatgattcacgacgcccacacccacacgctccactcagatggcctcggtgaggt cttcgagaacatcgcggaggccgagcgaaagggcctttcgctcgtagctataacagaccacagccactatctcctgcgtg gtaacttcaacgcctaccttagcgagataaggcgctggggcgaggatagtgagataacggttttagctggaatcgagggc aacataacccccaacggcgttgacgtgccggactggatggccaaaaagctcgacttcgtgatagcaagcgttcacgagtg ggttgaccggccggagcagtacgttgagctcgtcagggttgcactcctcgacgagaacgtcgatgtaataggccatttcg gggcaagctttccctacataggttatcctccttgggaggaccttttggagctcataacgctcgccgaggaaaatggtaag gccttcgagataagctcccgctaccgcgttccggatctggagttcgtgagggagtgcataaggaggggcgttaagctgac cttcgccagcgatgcccacaggccggaaaaagttggaaacgtcggctggagcgtgagcattttcaaaaaagctggaggaa agcttgaggatctgctgtttgaagagtttctg TAAGCGCTTGGATCTTAAGTGAATTCACATGAGGGCGCCTCAAGATA AACTCCTCTTTCAATTCTCCTAGAGTCTTATTGCAACTCTACGTCGACGTGAACCTCGACAACCACCCGCCCTCGGCCCC CCTTTCAATTCTCCTAGAGTCTTATTGCAACCCGGAACATACATCCAGAGCTACGACGCCTACGTGGCCTTTCAATTCTC CTAGAGTCTTATTGCAACCGGGGACGACTGTAAACGTGAATGACTTGCTAAATATCATTACTTTCAATTCTCCTAGAGTC TTATTGCAACGTGCCCGTCATCGTGGCGGAGGACTTAACCCCTGCTCAAGCGACTTTCAATTCTCCTAGAGTCTTATTGC AACCTTGATCCAGCCGCACATGAGTGTTCTTGACAGGGAGAAACCTTTCAATTCTCCTAGAGTCTTATTGCAACCTGCTC TTCATCAGCGACGTTCTCGACGAGGCCGAACTCTTTCAATTCTCCTAGAGTC