tg1936

Coordinates:1861248-1861982

>tg1936 Cell division ATPase MinD (minD)
MGHLISIASGKGGTGKTTTTANLSIALGKLGKKVLAIDADLTMANLSLVMGIDDAETTIHDVLAGEASISDAIYQTSFEN
VDLIPAAIDWEHVKKADPRKLPGTIKPLKGYYDFLIIDCPAGLQMDAMNAMLSGEEVILITNPEISCITDTMKVGIVLKK
AGLAVLGFVLNRYGRSENDIPPEAAEEVMEVPLLVVVPEDPKVREATLEGVPVVEYDPDSEGAKAFMKLAEEVLKIAGFK
ARVMY

>tg1936 Cell division ATPase MinD (minD)
atggggcatttgatatcgatagcgagcggtaagggaggaaccggcaagaccacgaccaccgctaacctctccattgccct
tgggaagctgggtaagaaggttctcgcgattgacgccgacctgactatggccaatctgagccttgtcatgggcatagatg
acgcggaaacaacgatccatgacgttcttgcgggggaggcttccatctccgacgcaatatatcagacaagcttcgagaac
gtcgatctgataccggccgcgatagactgggagcacgtcaaaaaagcggaccccaggaagttgccaggaactataaaacc
cctcaaaggatactacgacttcttgataatcgactgccccgccgggcttcagatggatgcgatgaacgcgatgctgagcg
gcgaggaggttatcctgataacgaaccccgaaatctcgtgtataaccgacacaatgaaagttggaatcgtccttaagaag
gcaggtctagctgttcttggcttcgtgctcaaccgctacggcaggagcgagaacgacatacccccggaggccgctgaaga
ggtcatggaggttccactactcgttgtggttcccgaggatccgaaggtcagggaggcaacgctggagggcgttcccgttg
ttgagtacgatcccgattctgagggagccaaggccttcatgaagctggccgaagaggtgctgaagatagccggcttcaag
gcgagggttatgtac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1860748 - 1862482 (Additional range around tg1936 is :500nt.)

>Thermococcus gammatolerans EJ3 GGCGAACCTCCCTCTTTGCCGTCAGGTAAATCACGTCGATACCCTTCGCTATGGCTATATCCCTCTGCACCTGGTCGCCG GTGATGAGCGTTGCGTTGAGTTGCTTCGCCGTCTCTCTCACGAGGTGGTCTATCTCGCCGGCCTTGGCCCGTCTAATCTG CCAGAGCTCCGGCCTCTCGCCGTAGAACTCGAGGAGTATCTCTCCCCTGTCGGCCATGTCGCGCAGTTTTTTAAGCTCCT CAAGGCCCGTATGTCCTATCGCCTTCCCCTCGTTCGCCTGATGCTCTATCTCGGCTATGACCGCTTCCGGAACGACGACC TTGACCTTCTCGTCGAGGGTTGAGAGGAACTGCGTTAACCTGCCATCAACTATCACGCTCGTGTCAGGAACGAACACTTT CATCTCTCTCACCTGGCCTAACTTGATGGAACGGTTCATAAGGTTTTAGCCTCCCCTAAAGCTTCATAAAGGTTTAGGAA TAAGTCCTATGGGTGGGATC atggggcatttgatatcgatagcgagcggtaagggaggaaccggcaagaccacgaccac cgctaacctctccattgcccttgggaagctgggtaagaaggttctcgcgattgacgccgacctgactatggccaatctga gccttgtcatgggcatagatgacgcggaaacaacgatccatgacgttcttgcgggggaggcttccatctccgacgcaata tatcagacaagcttcgagaacgtcgatctgataccggccgcgatagactgggagcacgtcaaaaaagcggaccccaggaa gttgccaggaactataaaacccctcaaaggatactacgacttcttgataatcgactgccccgccgggcttcagatggatg cgatgaacgcgatgctgagcggcgaggaggttatcctgataacgaaccccgaaatctcgtgtataaccgacacaatgaaa gttggaatcgtccttaagaaggcaggtctagctgttcttggcttcgtgctcaaccgctacggcaggagcgagaacgacat acccccggaggccgctgaagaggtcatggaggttccactactcgttgtggttcccgaggatccgaaggtcagggaggcaa cgctggagggcgttcccgttgttgagtacgatcccgattctgagggagccaaggccttcatgaagctggccgaagaggtg ctgaagatagccggcttcaaggcgagggttatgtac TGAGGTGATGCCATGATAGTTGCCTTTCTCGGAACTGCAGGAA GCGGAAAAACTACAATGGCCGGCTCCTTCGGAAGGTACCTCGAGGAGCAGGGGCATAGCGTCGCCTACGTGAACCTTGAT ACAGGGGTAAGAAAGCTCCCCTATGAGCCAGATCTCGACGTGAGGGAGATAGTAACCGTTGAGGAGCTCATGGCCGAGGG ATACGGGCCCAACGGCGCTATAGTGGAAAGCTACGACAGGCTCCTCTCGGAGGTCGGCAGGATAGCACGGGAGATACTCA AACTTGACGGGGAAAGGGAGTACACCCTAATAGATACACCCGGCCAGATGGAGAGCTTCCTCTTCCACGAGTTTGGGGTT AAGCTCATGGAGAGCCTCAGCGACCCCCTCCTCGCCTACCTTTTCGATCCCGAGATCCTGAAAAGGCCCCACGACTACTG TTTCGTGAGGTTCTTCGCCCTGATGATAGACCTCCGGCTCGGTACAACGACTGTTC