tg1948

Coordinates:1872446-1872949

>tg1948 hypothetical protein TGAM_1948
MATEPKRTLVAIVDLLTLKVEVVTPVKFKCVEDCGRCCYELEIPLRDEDIEAIEELGYSAWEFVDYEKMFYRGDRFLGYA
LKKRPFDDGCVFLDPETKRCRIYPKRPMACRLYPFVFVKHGSKMEVYIKEDSFCPGINHPDGELVDSSFLLREYGWLFEE
YRRKLGER

>tg1948 hypothetical protein TGAM_1948
gtggccaccgaacctaagagaacgctggtggccatagtcgatcttttaactttgaaggtcgaggtggtcacacccgtaaa
gttcaaatgcgttgaagactgcggacgctgctgctatgagcttgaaatcccgctgcgcgacgaggacattgaggcgatcg
aggagctcggatacagtgcatgggaattcgtggactatgagaagatgttctatcgtggcgacaggttcctcggttatgct
ctcaaaaagcgacccttcgatgatggttgcgtttttctcgatccagagacgaagaggtgcaggatataccctaagaggcc
aatggcgtgcaggctgtacccctttgtcttcgttaaacacggaagcaagatggaggtttacattaaagaggactccttct
gccctggaataaaccatcccgatggcgaactcgtcgatagcagttttctccttcgcgagtacgggtggctctttgaggag
taccggcgaaagctcggagagaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1871946 - 1873449 (Additional range around tg1948 is :500nt.)

>Thermococcus gammatolerans EJ3 AAAAGCTCAGGCGATACCGCATTATAATGGACTCCATGACGGAAGAGGAGCTGGAGAACCCGGACATAATAAACTACTCC AGGATAAAGAGGATAGCCAGGGGTTCTGGAACATCAACGCGCGAGGTCAGGGAGCTTTTGGCCCAGTACAACCAGATGCG AAAAATGTTTAAGAACTTAGACAAAAGAAAATTGGCAAAGATGGCCAAGAAGTTCAACTTTGGAGGGCTGGGGATATGAA GAAGATTGAGGCAATAATTCTCGTGGTTGCCAGGCCCGGTACTGAGGAAAAGGTCTACGAGAAGCTGAAGAAGCACCCCA ACGTCAAGGAGATATACAGGGTCTACGGTGAGTACGACCTGATCCTAAGGGTTGAGGTCGACACGATAGAGGATCTTGAC AGATTTCACGATGAAGTCCTGAGGAGGATCAGGGAGATAGAGCTAACTGAGACGCTTATAGCCAGCACCTACGGCCTAAA GGAGGGCTGAGGTGAGAGA gtggccaccgaacctaagagaacgctggtggccatagtcgatcttttaactttgaaggtc gaggtggtcacacccgtaaagttcaaatgcgttgaagactgcggacgctgctgctatgagcttgaaatcccgctgcgcga cgaggacattgaggcgatcgaggagctcggatacagtgcatgggaattcgtggactatgagaagatgttctatcgtggcg acaggttcctcggttatgctctcaaaaagcgacccttcgatgatggttgcgtttttctcgatccagagacgaagaggtgc aggatataccctaagaggccaatggcgtgcaggctgtacccctttgtcttcgttaaacacggaagcaagatggaggttta cattaaagaggactccttctgccctggaataaaccatcccgatggcgaactcgtcgatagcagttttctccttcgcgagt acgggtggctctttgaggagtaccggcgaaagctcggagagaga TGAGCAACCGAAACCTATTTATACATTTTTTTGTT AATCAGTGGGCACCGGGGGTGAGTGCATGACACAGTTGAAGTCAGTGCAGGAAAAGATCAGGCTCGTTAACATGCTCAGG CTCCTCAAGAAGAGCTACACATACGAGGAGCTCTCAAAGATAACGGGACTGCCGATAACGGTGCTGAACAGGTACGTTCG CGGAAAGGTGCTCCCGAGCACCGAGCGAACGAAGGCCCTCATCGAGCTCCTAAGTCCCTACATTGATCTCAGGGCGGAGG TCAGGAAGAGGCTCAAGTTTGACAGCAGGGGCTTCTTTGACACTATGGCGGTTTTGAGTGACACATCGCTCATGACCCTT CTCTCTGAGGAGCTTGCCGGCAGGCTCTCGGAGCTGAACCCCGACAAGATACTGACGGCGGCGACCGATGGCATACCCTT TGCCGTCCACATCGGCAGGCAGCTTGGGGTTGACGTTGTCTACGCCAAGAAGAAGAAGGAAGTTG