tg1953

Coordinates:1876397-1877197

>tg1953 Methylthioadenosine phosphorylase (mtaP)
MVRIAIIGGSGVYDPKLLENVREEIVETPYGTVRVKIGTYRGEEIAFLPRHGEKHSVPPHKINYHANIWALHELGVERIL
ATSAVGSLNLDMKPGDFVVLDQLMDFTKTRHYTFYDGEDSPHDRKFVAHVDFTDPYCPELRKALITAAKELGFTYHPTGT
YSCMEGPRFETRAEIRALKILGADVVGMTQCPEAVLARELEMCYASVAIVTNYAAGISREKLTHTEVVELMAKKGEEIKL
LLMKAVEHIPKERRCPCKDALKGATGE

>tg1953 Methylthioadenosine phosphorylase (mtaP)
atggtcaggatagccatcattggaggctccggtgtctacgacccgaaactgcttgagaacgttagggaagaaatcgttga
gacaccctacggaacggtccgggttaagataggaacctacagaggagaggagatagccttcctgccaagacacggagaaa
aacacagcgttccacctcacaagataaactaccacgccaacatctgggcgcttcacgagctcggcgtcgagaggattttg
gcaacttcagccgttggctctctcaacctcgacatgaagcccggcgacttcgtcgtcctcgaccagctcatggacttcac
gaagacgaggcattacactttttatgacggcgaggacagccctcacgacaggaagttcgtcgcccacgtggacttcaccg
acccctactgcccggagctcaggaaggccctcattacggccgccaaggagctcggcttcacctaccacccaacgggaacc
tactcctgcatggagggaccgcgcttcgagacgagggccgagataagggcgctcaagatactcggcgcagacgtcgttgg
tatgactcagtgccccgaggcggttctcgcgagggagcttgagatgtgctacgcgagcgttgccatagttaccaactacg
ccgctgggataagcagggaaaagcttacccacaccgaggtcgtcgagctcatggcaaagaaaggtgaggagataaagctc
ctcctaatgaaggccgtcgagcacattccgaaggagcgccgctgtccgtgcaaggatgccctcaagggcgctactggtga
g


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1875897 - 1877697 (Additional range around tg1953 is :500nt.)

>Thermococcus gammatolerans EJ3 GACTAAGCCCTGAGGAATTCGATGGGGTTGCCAAGGCCACCCTCGATGCTCTGCTCGAGAAAAACCCCTCTCCAGAGTAC AGGGGTGTCGTGGAGTTCCTAGGGAGAAACACCGAGAATGAGAGGGTTCTGGTTAAGGTCGCGACGTACTTGGCAAAGAT AGGGAACTTCGAGACTGCAGAAGAATTCGGGAGGATGATAGACGATCCTTACCTGAGATCTCTCGCCTTTGGGGCAATAG CTCTTGAAAAGCTCAGGAGAGAAGACATTGACGGGGCAATAGACGCCGTTAAAAACGTTCCCGACGCCGAATGGGGGTCC TGGCTGATGGGTGAGATACTCGTTAAAATCGTGGAGGGATCCCTTGGAGAATACCCAGAGCGAGAGCTGGAGAGGAAAGC CGAGCTTCACCGGAGAAGCATAGAAGGATCCTAGGAAGGGTCTAAAGTTTTAAACCCCCACGCCGTTCTATTTTCTACAG CTATTCAGGGGGAGTGAGAT atggtcaggatagccatcattggaggctccggtgtctacgacccgaaactgcttgagaa cgttagggaagaaatcgttgagacaccctacggaacggtccgggttaagataggaacctacagaggagaggagatagcct tcctgccaagacacggagaaaaacacagcgttccacctcacaagataaactaccacgccaacatctgggcgcttcacgag ctcggcgtcgagaggattttggcaacttcagccgttggctctctcaacctcgacatgaagcccggcgacttcgtcgtcct cgaccagctcatggacttcacgaagacgaggcattacactttttatgacggcgaggacagccctcacgacaggaagttcg tcgcccacgtggacttcaccgacccctactgcccggagctcaggaaggccctcattacggccgccaaggagctcggcttc acctaccacccaacgggaacctactcctgcatggagggaccgcgcttcgagacgagggccgagataagggcgctcaagat actcggcgcagacgtcgttggtatgactcagtgccccgaggcggttctcgcgagggagcttgagatgtgctacgcgagcg ttgccatagttaccaactacgccgctgggataagcagggaaaagcttacccacaccgaggtcgtcgagctcatggcaaag aaaggtgaggagataaagctcctcctaatgaaggccgtcgagcacattccgaaggagcgccgctgtccgtgcaaggatgc cctcaagggcgctactggtgag TGATGTCTTTTTTTCTCAATTTCTTCCAAAAGCACCTCCGAAGGAATCATGAATTTT AGCCAAGATTCTCAAACGGCTTTAATGGGAGGCGGTGAAATGCCAGTTCGAAGGGCTCCCAGACGTCCTTTTTGGCCATT TACAACTTTGTATTGGCCCCTTCAGGAGGAAACCTTGAACAATGAGCACGTGAACGAGAAACCTGCTTTAGAACTCACAG TTCTCAGAAAAGTGCTCCTTTCTACCAGCACTCATAAGGCCAAAGTTTGTGGTGCGGTGGCCGGGATTTGAACCCGGGCC AGCGGCGTGGCAGGCCGCTGTCCTAGCCAGGCTAGACTACCACCGCACAGGCCCGTTAATACTCAATCTTGGCGGCTTTA TAAATCTTTCGGTAAAGTTTTTTCAGTGCTAAGGACCTATTTACCCCGGTGGAACCCGTGAAGAGGGCCCAGAGCTCCTT AGAATATCTGCTGATAGCGGTTGTTGCACTTATCGTTATCGC