tg1962

Coordinates:1882805-1883014

>tg1962 DNA-directed RNA polymerase subunit N (rpoN)
MRCEKMIVPVRCFTCGKVLADKYYEFRKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQVMVYKVY

>tg1962 DNA-directed RNA polymerase subunit N (rpoN)
ttgaggtgtgagaaaatgatagtccccgtcaggtgcttcacctgcggaaaagtgctggcggacaagtactacgagttcag
gaagagagttgaggccggggaagaccctggcaaggtcctcgatgacctcggcgttgagaggtactgctgcaggagaactc
tcctcagccacgtggagctcatcgaccaggtaatggtttataaagtctac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1882305 - 1883514 (Additional range around tg1962 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTGCCACGCCGAAGTACGTCACCGTTGGTGAAGTTGCCAAGTTCCTCGGTGGAAAGTTCTGAGGTGAGAAAGATGAGGG TTATCCAGACTGCTGGTAAGAGAAAGACGGCCATTGCGAGGGCCACCATTAGGGAAGGGAAGGGTCGCGTTAGGATCAAC CACAAGCCCGTCGAGATAATCGAGCCCGAGATAGCGCGCTTCACCATCATGGAACCGCTCATCCTCGCTGGAGAGGAGAT AGTCAGCAAGGTTGACATCGACGTCAAGGTCGAGGGCGGAGGCTTCATGGGTCAGGCCGAGGCCGCGCGCGTTGCCATCG CCAGGGCTCTCGTTGAGTGGACCAACGACATGAACCTGAAGGAAAAGTTTATGAAGTACGACAGGACTATGCTCGTTGGC GACAGCAGGAGGACCGAGCCCCACAAGCCCAACCGCTCGACCAAGGGTCCGAGGGCTAAGAGGCAGAAGTCCTACCGCTG ATGGCTTTCCTTTAACAAT ttgaggtgtgagaaaatgatagtccccgtcaggtgcttcacctgcggaaaagtgctggcg gacaagtactacgagttcaggaagagagttgaggccggggaagaccctggcaaggtcctcgatgacctcggcgttgagag gtactgctgcaggagaactctcctcagccacgtggagctcatcgaccaggtaatggtttataaagtctac TAAAAACCG CAATTCTTGGGGGGCCGTGGGGTAGCTTGGTCTATCCTCCCGGCTTGGGGTGCCGGAGACCCGGGTTCAAATCCCGGCGG CCCCACCAAAATTTGCAGAGGATGCTTGGAGGGAGGGCAATGTTTAGGTACACCCGCTTTGAAAAGGCCCGTATCATCGG GGCGAGAGCTCTCCAGATTGCGCTCGGTGCTCCGGTCCTAGTGGACGTGCCGGAAGGCTCAACTCCACTTCAGGCCGCGA TAATCGAGTTCGAGAAAGGAATAATCCCGATCACAGTAATCAGGCCGAGCTGATGAAAAATGACCATCATAGAGAACGTT ATCGGCAGGGTGGCCGTACTCAGGGGCGGCAAGTATTCGGTTGAGGTGGACGTCATAACCAGTTCGGGCTTTGGTCGATT CGCCGCCCCCATCGATGAGGATCCCCACCTTTACATAGCCGAAGCACATAGAGCCGTGAGTGAAGTCGACGAGATAATAG GGCCCGAGCTT