tg1965

Coordinates:1883889-1884251

>tg1965 LSU ribosomal protein L18E (rpl18E)
MVKRTGPTDINLRRLIRYLRKKSNEEGVRIWKDIAWRLERPRRQRAEVNVSKINRYTKEGDVVIVPGSVLGAGKLEHRVT
VAAWKFSETAKRKILEAGGEAITIEELMERNPKGSGVIIME

>tg1965 LSU ribosomal protein L18E (rpl18E)
atggtcaagagaactggtccgaccgatatcaacctgaggaggctaatccggtacctcagaaagaagtcgaatgaagaggg
agttaggatatggaaggacatcgcctggcgccttgaaaggccgaggaggcagagggctgaagtgaacgttagcaagataa
accgctataccaaagagggcgacgtggtcatcgttccgggaagcgtcctcggtgcaggaaagcttgagcacagggtcacc
gttgccgcttggaagttcagcgagaccgctaagaggaaaatcctcgaggccggtggcgaggccatcaccattgaggagct
tatggagagaaatccgaagggtagtggagtaatcataatggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1883389 - 1884751 (Additional range around tg1965 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAAGTGGCAGCCGGGTTTCGTGTATTACAAGTACCTTACCGAGATACATGTAAGCAAAGAAGTCCCCGACTGGGAGGAG CTTAAGGAACTCGCCGAGAGGCGCGGATTACCCGTTGAGGAAAAAAAAGACGAGATAATCATAAAGACCATCAAGGCCTT CTACCTCCCGAGGAAGTTCGAGGCCTACGAGGGCGACAAGATCCGTGAAGAGATAATACCCGGGGCGTTCGTCTTTACCG TGGAAACGAACGGAGAGCTCCCCGTTGAGGAAATCGTGAGCATAGCGCTCAAGATACTCATGAGGAAGAGCGATAGATTT ATAAACGAACTCCATAAATTAGCCGACTGACGCGGGGGTTGCCGAGCCTGGTCAAAGGCGGTGGACTCAAGATCCACTCC CGCAGGGGTTCCGGGGTTCAAATCCCCGCCCCCGCATCAGTTTCACGCTCACCCCGTCCGCTGTCGGTTTCCCTGCGAGA GCGTTGAGGAGGTATGTTC atggtcaagagaactggtccgaccgatatcaacctgaggaggctaatccggtacctcaga aagaagtcgaatgaagagggagttaggatatggaaggacatcgcctggcgccttgaaaggccgaggaggcagagggctga agtgaacgttagcaagataaaccgctataccaaagagggcgacgtggtcatcgttccgggaagcgtcctcggtgcaggaa agcttgagcacagggtcaccgttgccgcttggaagttcagcgagaccgctaagaggaaaatcctcgaggccggtggcgag gccatcaccattgaggagcttatggagagaaatccgaagggtagtggagtaatcataatggag TGATGGGCCATGAGGA TTATTAACGCTGAAGGACTCATACTCGGAAGGCTCGCCTCGAAGGTTGCCAAGATGCTCCTCGAGGGCGAAGAGGTCGTT ATCGTCAACGCCGAGAAGGCCATAATCACCGGAAACCGCGAGGACATCTTCGCCAAGTACAAGCAGAGGACCGAGCTCAG AACCAGGACCAACCCGAGGAGGGGTCCCTTCTACCCGAAGAGGAGCGACGAGATAGTCAGGAGAACCGTCAGGGGCATGC TCCCCTGGAAGACTGACCGCGGAAGGAAGGCCTTCAAGAGGCTCAAGGTCTACGTCGGCGTTCCCAAGGAGTTCGAGGGC AAGGAGCTCGAGACCATAAGCGAGGCCCACATGTCGAGGCTTGCCACGCCGAAGTACGTCACCGTTGGTGAAGTTGCCAA GTTCCTCGGTGGAAAGTTCTGAGGTGAGAAAGATGAGGGTTATCCAGACTGCTGGTAAGAGAAAGACGGCCATTGCGAGG GCCA