tg1971

Coordinates:1887357-1888058

>tg1971 hypothetical protein TGAM_1971
MRDLSRFLHFLDAFSSSVETRGVLLFMRFVLLWFWLDVLLFLLLGLFEYSIRNIFSSGILLLVWLVALTLPRVFRKLEGF
GSHPGFTYLLAVLLMALFEETLVTLNGGGLGGRATGLAHDLTIAVPVFVGVGTGFYLAHRMAPMSRGAFFLFGALFGFFI
EIVLNGAWSGLVLLGGGAMGLYGMILSAHTPVVERPSPLGVKKVLIVTFLGTMFMLVGAVAGDTLWRLAGGSPL

>tg1971 hypothetical protein TGAM_1971
gtgagagacttgtcccggtttctccactttctcgatgccttttcttcttcggttgagactcgaggggtactgcttttcat
gaggtttgtcctcctctggttctggcttgatgttctgctctttctgctcctcggcctttttgagtactccatcagaaaca
tcttcagttctgggatactcctcctcgtatggctcgtggcgttaactttacccagggtttttagaaaattggaggggttt
gggagccatccgggtttcacgtaccttcttgccgttcttttgatggcgctgtttgaagaaacgctggtgaccctgaacgg
gggtgggcttgggggcagggcgacgggcttagcacacgatctgacgatagccgttccggtcttcgtgggggttggaacgg
ggttttatctggctcatcgaatggcaccgatgtcgcgcggtgcgttcttcctcttcggagcgctctttggattcttcatt
gagatagttctgaacggtgcttggagcggtttagtgttgctcggcgggggtgcgatgggtctctacggcatgatactatc
cgcccacacgccagtggttgaaaggccgtcacctctgggggttaagaaggttctaatcgttacgttcctcggaacgatgt
tcatgctcgttggggctgtagctggggacaccctctggcgtttggctggaggttcaccttta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1886857 - 1888558 (Additional range around tg1971 is :500nt.)

>Thermococcus gammatolerans EJ3 TGCTCTTTCGCGTTGGTGTCGAGGCGGGAACGTACATACGTTCGCTTATCCACCACATAGGCCTGGCTTTGGGCGTTGGA GCGCACATGGCAGAGCTTCGTCGTACCAGAAGCGGTCCCTTCAAGGAGGACGAGACGCTGGTGACGCTTCACGATTTGGT TGACTACTATCACTTCTGGAAGGAGGACGGCATCGAGGAGTACTTCAGGAAGGCGATACAGCCGATGGAAAAGGCGGTTG AACATCTGCCCAAGGTGTGGATAAGGGACTCTGCCGTTGCGGCGGTGACGCACGGCGCTGACCTGGCCGTTCCCGGAATA GTCAAGCTCCACAAGGGTATAAAGAAGGGTGACCTCGTTGCGATAATGACCCTCAAGGACGAGCTGGTGGCACTTGGAAA GGCCATGATGACGAGCGGTGAGATGCTCCAGCGGAGCAAGGGCATAGCGGTTGACGTTGACAAGGTCTTCATGCCGAGGG ACTGGTATCCGAGAATGTG gtgagagacttgtcccggtttctccactttctcgatgccttttcttcttcggttgagact cgaggggtactgcttttcatgaggtttgtcctcctctggttctggcttgatgttctgctctttctgctcctcggcctttt tgagtactccatcagaaacatcttcagttctgggatactcctcctcgtatggctcgtggcgttaactttacccagggttt ttagaaaattggaggggtttgggagccatccgggtttcacgtaccttcttgccgttcttttgatggcgctgtttgaagaa acgctggtgaccctgaacgggggtgggcttgggggcagggcgacgggcttagcacacgatctgacgatagccgttccggt cttcgtgggggttggaacggggttttatctggctcatcgaatggcaccgatgtcgcgcggtgcgttcttcctcttcggag cgctctttggattcttcattgagatagttctgaacggtgcttggagcggtttagtgttgctcggcgggggtgcgatgggt ctctacggcatgatactatccgcccacacgccagtggttgaaaggccgtcacctctgggggttaagaaggttctaatcgt tacgttcctcggaacgatgttcatgctcgttggggctgtagctggggacaccctctggcgtttggctggaggttcacctt ta TAAACCCCTCAACGAAGCACCCCCACATGAGCCACTACTACTCCGAAGAGCCAAACGTTCCGCTGAAGACGAAAACC ATTGATGTCTGCGTTAGGGGTTACTGCTTCAAGTTCATCACGGCGAGCGGTGTCTTCTCCTTCGGGAAGCTCGATAGGGG GACGGAGCTGCTCATAGAGAACATGGTGCTCGACAGGGGCTGGCGCGTCCTTGACCTGGGCTGTGGTTACGGGGCAATTG GGATAGTTGCATCGCGCTTCGTTGACTACGTCGTCATGACCGACGTGAACAAACGTGCAGTTAGCATAGCGAGGAAAAAC TTAAAAATCAACGGCGTTAGAAACGCCGAGGTCAGGTGGGGAAGCCTCTACGAGCCCGTTAAGGGCGAGAAATTTGACTC AATCATCACTAATCCCCCCGTGCACGCGGGAAAGGAAGTCCTGAGGGAAATAGTTATAAACGCTCCCCGGCATCTCAACG ATGGTGGCCTCCTGCAACTGGTG