tg1976

Coordinates:1890345-1890611

>tg1976 LSU ribosomal protein L34E (rpl34E)
MKPMYRSRSWRRKYVRTPGGRTVIHFERRKPKVAHCAMCGRPLNGVPRGRPSELRKLPKTAKRPERPYPNLCPSCMRKVI
KAQVRASLS

>tg1976 LSU ribosomal protein L34E (rpl34E)
atgaagccgatgtaccgctcaaggtcatggaggaggaagtacgttaggactcccggaggaaggacagtgatccacttcga
gaggaggaagcccaaggttgcccactgtgccatgtgcggaagacccctcaacggcgttccgcgcggaaggccgagcgagc
tcaggaagctcccgaagaccgcgaagaggcccgagagaccctacccgaatctctgcccgagctgtatgaggaaggtcata
aaggcccaggtcagggcctccctcagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1889845 - 1891111 (Additional range around tg1976 is :500nt.)

>Thermococcus gammatolerans EJ3 GCTGGCGATAACGGTAGCGGGATTCGTTATAGGTGGCTCGTACACCTTGATCTATTACTTTTTCACGGACATTGAGAAGA CGAGAAAGATACAGAAGATGGCCAAAGAGATCCAGAAGGAGATGAAGGAGGCCCAAAAGTCCGGGGATGAGAAAAAACTG AGGAAGGTTCAGCAGAAGCAGATGGAACTCATGAAGATGCAGAGCGAGATGATGCGACAGCAGATGGTGCCCATGTTGCT TACTTTACCAATATTCTGGATATTCTTCGGCTGGCTGAGGAGGTGGTACGCCGAGGTTGCGATAGTCAAGGCGCCCTTCA ACTTTTTCATCTTCGACTGGTTCCATAAAATGTATCACTCGGCCCTCGGGCCAGATGAACTCGGCTACTTTGGCTGGTAC ATTCTTTCAAGCTACATAATCGGTATGGTGCTCAGAAAGTTCCTCGACATGGGTTAAATTTAAAAACGCTCCACTGATAG GGGTTGCGAGGTGAGAATT atgaagccgatgtaccgctcaaggtcatggaggaggaagtacgttaggactcccggagga aggacagtgatccacttcgagaggaggaagcccaaggttgcccactgtgccatgtgcggaagacccctcaacggcgttcc gcgcggaaggccgagcgagctcaggaagctcccgaagaccgcgaagaggcccgagagaccctacccgaatctctgcccga gctgtatgaggaaggtcataaaggcccaggtcagggcctccctcagc TGAGGTGCGCCTATGCCCAAGGGCTGCCTCGT CATCACCGTCAGCGGTCTTGCAGGTTCCGGGACGACTACCCTCTGCCGGAACCTCGCCAAGCACTACGGCTTCAAGCACA TCTACGCCGGGTTGATATTCCGGCAGATGGCGAAGGAAAGGGGGATGACCCTTGAGGAGTTCCAGAAGTACGTTGAGCTT CATCCCGAGATAGACAGGGAGGTTGACAGGAGACAGGTCGAGGCAGCCAAGGAGTGTAACGTCGTCATTGAGGGCCGCCT CGCTGGGTGGATGGTGAAGAACGCGGACCTTAAGATATGGCTCGACGCTCCGATTATGGAGCGCGCCAAGAGGGTTGCGC GCAGGGAAGGGGTCTCCGTTGAGGAGGCCTTCGTCCAGATCGCCGAGAGGGAGAAGCAGAACAGGAAAAGGTATTTAAAC CTCTACGGTATCGACATCGAGGACAAGTCGATTTACGATTTAATCATAAACACCGCCAAATGGGGTCC