tg1978

Coordinates:1891171-1891758

>tg1978 Archaeal adenylate kinase (ATP-AMP transphosphorylase) (adkA)
MPFVVMITGIPGVGKSTITRLALKRTAINFRLVNFGDLMFEEAVKQGLVKHRDEMRKLDPMVQKQLQLRAAQRIVEIARD
EPVLLDTHATIRTPMGYLLGFPKEVIETIRPNFIVIIEATPSEILGRRLRDLKRDRDVETEEQIQRHQDLNRAAAISYAM
HSDALIKIIENHEDKGLEEAVNELVQVLNLAVREYD

>tg1978 Archaeal adenylate kinase (ATP-AMP transphosphorylase) (adkA)
atgccgtttgtggtcatgataaccggcattcccggagtgggtaagagcacgataacgcggcttgccctcaagagaacggc
catcaacttcagactagtaaacttcggtgacttaatgttcgaggaggccgtcaagcagggtttagtcaagcacagggacg
agatgaggaaactcgatcccatggtgcagaaacagctccagcttcgcgccgcgcagaggatcgttgagatagcccgggat
gagccggttctcctcgacacccacgccacgatcagaacgcctatgggctatcttctcggcttccctaaggaggttataga
gaccatcagacccaatttcatagtcataattgaagccacaccgagcgagatcctcggaaggcggcttcgtgacctcaaga
gggacagggacgtcgagacggaggagcagatacagaggcatcaggatctcaacagggccgcggcgataagttacgccatg
cattccgatgcccttataaagataatcgagaaccacgaggacaagggtcttgaagaggccgtgaacgaactcgttcaagt
ccttaacctggcggtgagggagtatgat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1890671 - 1892258 (Additional range around tg1978 is :500nt.)

>Thermococcus gammatolerans EJ3 ACACGGTTCCTCCGTACGATGTATTCCAGCTGGTTCACCATCCGGGCCACGCGCTCATCTACGCGATTCAGACGATATTC TGGTCAGTGCTCTTCGGATTCCTCTGGGTTGAGCTGACGGGACTCGACGCCAAGAGCATCGCAAGACAGCTCCAGCGCGC CGGCCTCCAGATCCCCGGGTTCAGGCGCGACCCAAGAATCCTTGAGAGAGTTCTCCAGCGCTACATCCCCTACGTTACGT TCTGGGGCTCATTCACCCTCGCAATAGTTGCGGTACTGGCCAGCTTCCTTGGTGCCCTGGGTACTGGAACCGGAATACTG CTGACGGTCGGCATACTCTACAGGTTCTACGAAGAGATAGCAAGGGAGCAGGCAACGGAGATGTTCCCGGCTTTGAGGAA GTTCTTCGCGAGCCGCTGAAGGTTTTTAATTTTTCCTTCCCAAATCTTTTAAAGTGACCTCCCAATTTTTACCGGGATTG TTTAAAGCGGGTGGTGCTG atgccgtttgtggtcatgataaccggcattcccggagtgggtaagagcacgataacgcgg cttgccctcaagagaacggccatcaacttcagactagtaaacttcggtgacttaatgttcgaggaggccgtcaagcaggg tttagtcaagcacagggacgagatgaggaaactcgatcccatggtgcagaaacagctccagcttcgcgccgcgcagagga tcgttgagatagcccgggatgagccggttctcctcgacacccacgccacgatcagaacgcctatgggctatcttctcggc ttccctaaggaggttatagagaccatcagacccaatttcatagtcataattgaagccacaccgagcgagatcctcggaag gcggcttcgtgacctcaagagggacagggacgtcgagacggaggagcagatacagaggcatcaggatctcaacagggccg cggcgataagttacgccatgcattccgatgcccttataaagataatcgagaaccacgaggacaagggtcttgaagaggcc gtgaacgaactcgttcaagtccttaacctggcggtgagggagtatgat TGAGGGTATATACCAGCTCCTCGACAATATC TTTGGCGGTTACATCGTTCAGCACCCCCTGCTGGCGATAACGGTAGCGGGATTCGTTATAGGTGGCTCGTACACCTTGAT CTATTACTTTTTCACGGACATTGAGAAGACGAGAAAGATACAGAAGATGGCCAAAGAGATCCAGAAGGAGATGAAGGAGG CCCAAAAGTCCGGGGATGAGAAAAAACTGAGGAAGGTTCAGCAGAAGCAGATGGAACTCATGAAGATGCAGAGCGAGATG ATGCGACAGCAGATGGTGCCCATGTTGCTTACTTTACCAATATTCTGGATATTCTTCGGCTGGCTGAGGAGGTGGTACGC CGAGGTTGCGATAGTCAAGGCGCCCTTCAACTTTTTCATCTTCGACTGGTTCCATAAAATGTATCACTCGGCCCTCGGGC CAGATGAACTCGGCTACTTTGGCTGGTACATTCTTTCAAGCTACATAATCGGTATGGTGCTCAGAAAGT