tg1981

Coordinates:1893727-1894191

>tg1981 LSU ribosomal protein L30P (rpl30P)
MAKLALIRLRSGIRARGEVRDTLAMLRLHRINHLVIVDDTPSYRGMIQKVKDYITWGEIDKETLVKLLRKRGRLVGNKPI
TDEYVKEKLGMTIEEFAEKVINGEMKLRDLPNIKPVFRLHPPRGGLKGSKKRSFKEGGALGYRGEKINELIERML

>tg1981 LSU ribosomal protein L30P (rpl30P)
atggcaaagcttgcactcataaggcttaggagcgggattagggcgaggggcgaggttagggacaccctcgccatgcttcg
ccttcacaggattaaccacctcgtcatagtggacgacaccccgagctaccgcggaatgatacagaaggtcaaggactaca
tcacctggggcgagattgacaaggagaccctcgttaagctcctcaggaagaggggcaggctcgtcggcaacaagccgatt
accgatgagtacgtcaaggagaagctcggaatgactattgaggagttcgccgagaaggtcatcaacggcgagatgaagct
cagggatttgccaaacatcaagcccgtcttcaggctccacccgccgagggggggcctcaagggaagcaagaagcgctcct
tcaaggagggcggtgccctcggctacaggggcgagaagattaacgagctcatagagagaatgctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1893227 - 1894691 (Additional range around tg1981 is :500nt.)

>Thermococcus gammatolerans EJ3 TGACCGACAGCGGTAGGAGGATTCGCTTCCGCGTTTTGGCGGCTGTGGGCAACAGGGACGGCTACGTCGGCCTCGGAATC GGCCACGGAAGGGAAGTTGGCATAGCCATCAGGAAGGCCATCAGCTACGCCAAGATGAACATCATCGAAATCAAGCGCGG CTGTGGCTCTTGGGAGTGCAGGTGCAGGAGGCCCCACTCAATCCCGTTCGCCGTCGAGGGCAAGGAGGGAAGCGTCCGCG TCAAGCTCATGCCCGGACCGCGCGGTCTTGGACTGGTCATCGGTGACGTCGGCAAGAAGATACTCAGCCTCGCTGGTGTC CAGGACGTCTGGTCCCAGACCCTCGGTGAGACGAGAACCACCGTCAACTTCGCCAAGGCAGTTTTCAACGCCCTCTACAA CACCAACCGCGTCGCCATACAGCCCGGTATGGAGGAGAAGTATGGTATCGTCGTTGGCAGGGCGATGCCCCAGAGCTTCG AGCTGTGAGGTGAGAGAAG atggcaaagcttgcactcataaggcttaggagcgggattagggcgaggggcgaggttagg gacaccctcgccatgcttcgccttcacaggattaaccacctcgtcatagtggacgacaccccgagctaccgcggaatgat acagaaggtcaaggactacatcacctggggcgagattgacaaggagaccctcgttaagctcctcaggaagaggggcaggc tcgtcggcaacaagccgattaccgatgagtacgtcaaggagaagctcggaatgactattgaggagttcgccgagaaggtc atcaacggcgagatgaagctcagggatttgccaaacatcaagcccgtcttcaggctccacccgccgagggggggcctcaa gggaagcaagaagcgctccttcaaggagggcggtgccctcggctacaggggcgagaagattaacgagctcatagagagaa tgctc TGAGGTGGCGAGAGATGATTAGGAGGAGAAAGAAGGTTAGGAAGCTTCGCGGGAGTCACACTCACGGATGGGGG TGCAAGAAGAAGCACCGCGGCGGCGGAAGCAAGGGCGGCCGCGGTATGGCGGGCACAGGTAAGAGGAAGGACCAGAAGTT CACCTGGACCATCAAGTACGCCCCCGACCACCTCGGCAAGCGCGGCTTCCACAGGCCCAAGGCCGTTCAGTACATCCCCA AGGTCATCAACCTGAGCGACATCGACGAGAACTTCGAGCTCTTCAAGGACATGGGCGTCATCTACGAGGAGGAAGGAAAG CTCGTCTTCGACGCCACCCAGCTCGGCGTTGACAAGGTTCTCGGTACAGGAAAGCTCACCCGCGCCATCGTCGTCAAGGC CTACTACGTTACCCCCAAGGCCGAGGAGAAGATTAGGGAAGCAGGCGGCGAGGTTGTCCTCGCCTGATTTCTTTACTCAT TGTACACAGCTACACCAAGGTGTTGA