tg1982

Coordinates:1894206-1894907

>tg1982 SSU ribosomal protein S5P (rps5P)
MSDPREIAQRVLEEWEPRTKLGRLVKEGQITDIHEIFRKGYQIKEPEIVDVLLPEVNLRENQEVLDIALTVRMTDSGRRI
RFRVLAAVGNRDGYVGLGIGHGREVGIAIRKAISYAKMNIIEIKRGCGSWECRCRRPHSIPFAVEGKEGSVRVKLMPGPR
GLGLVIGDVGKKILSLAGVQDVWSQTLGETRTTVNFAKAVFNALYNTNRVAIQPGMEEKYGIVVGRAMPQSFEL

>tg1982 SSU ribosomal protein S5P (rps5P)
atgagcgacccgagagagattgcccagagggttcttgaggagtgggagccgaggaccaagctcggcaggctcgttaagga
gggtcagataactgacattcacgagatattcaggaagggctaccagataaaggagcccgagatagttgacgttctccttc
ccgaggtcaacctgagagagaaccaggaagtgcttgacatagctctcaccgtcaggatgaccgacagcggtaggaggatt
cgcttccgcgttttggcggctgtgggcaacagggacggctacgtcggcctcggaatcggccacggaagggaagttggcat
agccatcaggaaggccatcagctacgccaagatgaacatcatcgaaatcaagcgcggctgtggctcttgggagtgcaggt
gcaggaggccccactcaatcccgttcgccgtcgagggcaaggagggaagcgtccgcgtcaagctcatgcccggaccgcgc
ggtcttggactggtcatcggtgacgtcggcaagaagatactcagcctcgctggtgtccaggacgtctggtcccagaccct
cggtgagacgagaaccaccgtcaacttcgccaaggcagttttcaacgccctctacaacaccaaccgcgtcgccatacagc
ccggtatggaggagaagtatggtatcgtcgttggcagggcgatgccccagagcttcgagctg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1893706 - 1895407 (Additional range around tg1982 is :500nt.)

>Thermococcus gammatolerans EJ3 TCGTCGTGAGGAAGAGCCTCAACCACCACATAGCTCAGATTATAGTCTACAACCCGAAGGGGGACAGGACTATAGTTTCC GCCCACACCAGGGAGCTCATCAGGGACTTCGGCTGGAAGGGCCACACCGGAAACACCCCGAGCGCCTACCTCCTCGGACT GCTCATCGGTTACAAGGCGAAGAAAGCCGGCATTGAGGAGGCAATCCTTGACATAGGCCTTCACCCGCCGACCAGGGGAA GCTCGGTCTTCGCCGTCCTCAAGGGAGCCGTTGATGCAGGCTTGAACGTCCCGCACAGCGAGGAGATATTCCCAGAGGAC TACAGGATAAGGGGCGAGCACGTTGCTGAGTACGCCAAGGCCCTCAAGCAGGAGGACGAGACCCTCTATAGGAAGCAGTT TGGTGGCTACCTCGTCAAGGGCCTTGAGCCCGAGAAGCTCCCCGAGCACTTTGAAGAGGTTAAGGCCAAGATAATCGAGA AGTTTGAGGGGGCGAGAGA atgagcgacccgagagagattgcccagagggttcttgaggagtgggagccgaggaccaag ctcggcaggctcgttaaggagggtcagataactgacattcacgagatattcaggaagggctaccagataaaggagcccga gatagttgacgttctccttcccgaggtcaacctgagagagaaccaggaagtgcttgacatagctctcaccgtcaggatga ccgacagcggtaggaggattcgcttccgcgttttggcggctgtgggcaacagggacggctacgtcggcctcggaatcggc cacggaagggaagttggcatagccatcaggaaggccatcagctacgccaagatgaacatcatcgaaatcaagcgcggctg tggctcttgggagtgcaggtgcaggaggccccactcaatcccgttcgccgtcgagggcaaggagggaagcgtccgcgtca agctcatgcccggaccgcgcggtcttggactggtcatcggtgacgtcggcaagaagatactcagcctcgctggtgtccag gacgtctggtcccagaccctcggtgagacgagaaccaccgtcaacttcgccaaggcagttttcaacgccctctacaacac caaccgcgtcgccatacagcccggtatggaggagaagtatggtatcgtcgttggcagggcgatgccccagagcttcgagc tg TGAGGTGAGAGAAGATGGCAAAGCTTGCACTCATAAGGCTTAGGAGCGGGATTAGGGCGAGGGGCGAGGTTAGGGAC ACCCTCGCCATGCTTCGCCTTCACAGGATTAACCACCTCGTCATAGTGGACGACACCCCGAGCTACCGCGGAATGATACA GAAGGTCAAGGACTACATCACCTGGGGCGAGATTGACAAGGAGACCCTCGTTAAGCTCCTCAGGAAGAGGGGCAGGCTCG TCGGCAACAAGCCGATTACCGATGAGTACGTCAAGGAGAAGCTCGGAATGACTATTGAGGAGTTCGCCGAGAAGGTCATC AACGGCGAGATGAAGCTCAGGGATTTGCCAAACATCAAGCCCGTCTTCAGGCTCCACCCGCCGAGGGGGGGCCTCAAGGG AAGCAAGAAGCGCTCCTTCAAGGAGGGCGGTGCCCTCGGCTACAGGGGCGAGAAGATTAACGAGCTCATAGAGAGAATGC TCTGAGGTGGCGAGAGATGATTA