tg1987

Coordinates:1896934-1897323

>tg1987 SSU ribosomal protein S8P (rps8P)
MTLLDPLANALSHITNSERVGKKEVYIKPASKLIGEVLRVMQENGYIGEFEFIDDGRAGIYRVQLIGKINKAGAIKPRFP
VKAKNYEYWEKRFLPAFEFGILIVSTSQGVMTHKEAREKGIGGRLIAYVY

>tg1987 SSU ribosomal protein S8P (rps8P)
atgactctgcttgacccgcttgcgaacgctctatcccatataaccaacagcgagagggtagggaagaaggaggtctacat
aaagcccgcctcgaagctcatcggcgaagtgctgagagttatgcaggagaacggctacatcggcgagttcgagttcatag
acgacgggagggccggcatctacagggttcagctcatcggcaagataaacaaggccggcgcgattaagccccgcttccct
gttaaggcaaagaactacgagtactgggagaagaggttccttccagcgttcgagttcggaatcctcatagtgtccacctc
ccagggcgttatgacccacaaggaggcccgtgagaagggcatcggcggaaggctgatagcctacgtctac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1896434 - 1897823 (Additional range around tg1987 is :500nt.)

>Thermococcus gammatolerans EJ3 CCGTGGAAAGAAGGCCTACGAGATGCTTGACAGGCTCCTTGAGGCCGTTGACAGGAAGCTCAGCGTCGGCAACTTCGACG AGCACGGGAACTTCTGCTTTGGAATCCAGGAGCACATCAACATACCGGGCGTCGAGTACGACCCCGAGATAGGTATCTTC GGTATGGATGTCTGCGTCACCCTTGAGAGGCCCGGTTTTAGGGTCGCCAAGAGGAAGAGGCAGAGGAGGAAGATACCGAC CAGGCACAAGCTGACGAAGGAAGAGGGTATAGTCTTCGCTATTGAGGAGTTCAAGGTCAACGTGGAGGGATTGTGAGATG GCGAAGGCTGATTACAACAAGAGGAAGCCGAGGAAGTTTGGTAAGGGAGCGAGAAGGTGCATGCGCTGCGGCCAGTACGG GCCGATAATCAGAATACACGGCCTTATGCTGTGCAGACACTGCTTCCGCGAGGTCGCCCCAAAACTCGGCTTCAAGAAGT ATGAGTGAGGTGAGATGAA atgactctgcttgacccgcttgcgaacgctctatcccatataaccaacagcgagagggta gggaagaaggaggtctacataaagcccgcctcgaagctcatcggcgaagtgctgagagttatgcaggagaacggctacat cggcgagttcgagttcatagacgacgggagggccggcatctacagggttcagctcatcggcaagataaacaaggccggcg cgattaagccccgcttccctgttaaggcaaagaactacgagtactgggagaagaggttccttccagcgttcgagttcgga atcctcatagtgtccacctcccagggcgttatgacccacaaggaggcccgtgagaagggcatcggcggaaggctgatagc ctacgtctac TGAGGTGAGAGCGATGCCGATAGACGCGTGGGTAAGGGAAGAGGTTGAGATTCCAGAGGGAGTCGAGGT CACCGTTGAGAACAACGTTGTCAAGGTCAAGGGCCCCAAGGGAGAACTTGAGAGGGAGCTCAAATACCCGGGCGTTAAGA TATTCACAGAGGACGGAAAGGTCGTGGTATACAAGGAGTTCCCGAGGAAGAAGGACATCGCCATCGCGAGGACCTTCAAG GCCCACATAAACAACATGATTAAGGGCGTAACCGAGGGCTTCACCTACAAGCTCAAGGTCGTTTACAGCCACTTCCCGGT TACCGTCAAGGTCCAGGGCGACGAAGTCATAATTGAGAACTTCCTCGGTGAGAAGAACCCGAGGAGGGCCAAGATCCTTC CGGGCGTCACCGTCAAGGTTCGCGGTCAGGAGATAACCGTTGAGGGCATAGACAAGGAAAAAGTTGGCCAGACCGCGGCC AACATCGAGCAGGCCACGAGGATAACGAAAT